(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4946

AL939122.SCO4946     Location/Qualifiers
FT   CDS             10116..10907
FT                   /transl_table=11
FT                   /gene="SCO4946"
FT                   /gene_synonym="2SCK31.06"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.06, hypothetical protein, len: 263 aa; highly
FT                   similar to TR:Q9L114 (EMBL:AL159139) Streptomyces
FT                   coelicolor hypothetical 27.0 kDa protein SCL6.02, 255 aa;
FT                   fasta scores: opt: 711 z-score: 830.9 E(): 0; 49.4%
FT                   identity in 253 aa overlap"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF2"
FT                   /protein_id="CAD30932.1"
FT                   /translation="MTYHASTPSTPLLVTGGTGTLGGHVVPLLREAGHDVRVLTRRTRP
FT                   ATGNGITYVTGDLRTGEGVEAAVDGVHTVLHLAGGPKGDDEATRTLVRAAARADVRHLA
FT                   YISVVGADRVPLAWLRTKLESERAIADSGLGWTVLRAAQFHELTLTMIEKMTRLPVLPV
FT                   PGGLRLQPVAAREVAVRLAELTLAEPSGRVPDMTGPEVLDLATLAHSYLDLRGGRRRPK
FT                   LPVRIPGKAGRAYRSGQNLTLEDALVGKVTWTEFLAERAAV"
     MTYHASTPST PLLVTGGTGT LGGHVVPLLR EAGHDVRVLT RRTRPATGNG ITYVTGDLRT        60
     GEGVEAAVDG VHTVLHLAGG PKGDDEATRT LVRAAARADV RHLAYISVVG ADRVPLAWLR       120
     TKLESERAIA DSGLGWTVLR AAQFHELTLT MIEKMTRLPV LPVPGGLRLQ PVAAREVAVR       180
     LAELTLAEPS GRVPDMTGPE VLDLATLAHS YLDLRGGRRR PKLPVRIPGK AGRAYRSGQN       240
     LTLEDALVGK VTWTEFLAER AAV                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page