(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4949

AL939122.SCO4949     Location/Qualifiers
FT   CDS             16483..17145
FT                   /transl_table=11
FT                   /gene="SCO4949"
FT                   /gene_synonym="narJ3"
FT                   /gene_synonym="2SCK31.09"
FT                   /product="nitrate reductase delta chain NarJ3"
FT                   /note="2SCK31.09, narJ3, nitrate reductase delta chain,
FT                   len: 237 aa; similar to SW:NARJ_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase delta chain (EC
FT                   1.7.99.4) NarJ, 184 aa; fasta scores: opt: 332 z-score:
FT                   411.9 E(): 2.1e-15; 35.0% identity in 163 aa overlap and to
FT                   TR:Q9RI30 (EMBL:AL109989) Streptomyces coelicolor NarJ2
FT                   SCJ12.30 , 267 aa; fasta scores: opt: 436 z-score: 447.2
FT                   E(): 3.3e-19; 41.7% identity in 204 aa overlap"
FT                   /db_xref="GOA:Q9EWF5"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF5"
FT                   /protein_id="CAD30935.1"
FT                   /translation="MSRSLGRAATTTNAPVVFQAAALLLAYPDRDWPRRPHTVRDTVAA
FT                   LPGPEIQLLLSFCDRAEREDPLAVAARYVATFDRSRRRCLYLTYYTDGDTRRRGAALAR
FT                   IKSVYRTHGWLPPDDELPDFLPLMLEFAARTPEAGTALLTEHRAAIEVLRYALEAHRSP
FT                   YAALLQAVGRCLPGRAPASREEALRLTRTGPPTEAVGLDVLGPFPAQPRPHDDGARR"
     MSRSLGRAAT TTNAPVVFQA AALLLAYPDR DWPRRPHTVR DTVAALPGPE IQLLLSFCDR        60
     AEREDPLAVA ARYVATFDRS RRRCLYLTYY TDGDTRRRGA ALARIKSVYR THGWLPPDDE       120
     LPDFLPLMLE FAARTPEAGT ALLTEHRAAI EVLRYALEAH RSPYAALLQA VGRCLPGRAP       180
     ASREEALRLT RTGPPTEAVG LDVLGPFPAQ PRPHDDGARR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page