(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4950

AL939122.SCO4950     Location/Qualifiers
FT   CDS             17142..17855
FT                   /transl_table=11
FT                   /gene="SCO4950"
FT                   /gene_synonym="narI3"
FT                   /gene_synonym="2SCK31.10"
FT                   /product="nitrate reductase gamma chain NarI3"
FT                   /note="2SCK31.10, narI3, nitrate reductase gamma chain,
FT                   len: 237 aa; highly similar to SW:NARI_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase gamma chain (EC
FT                   1.7.99.4) NarI, 223 aa; fasta scores: opt: 792 z-score:
FT                   991.9 E(): 0; 49.6% identity in 234 aa overlap and to
FT                   TR:Q9RI29 (EMBL:109989) Streptomyces coelicolor putative
FT                   nitrate reductase delta chain NarI2 SCJ12.31, 256 aa; fasta
FT                   scores: opt: 813 z-score: 891.7 E(): 0; 54.3% identity in
FT                   230 aa overlap. Contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9EWF6"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF6"
FT                   /protein_id="CAD30936.1"
FT                   /translation="MRHLHTALWGVLPYLTLVVLVAGTAWRYRYDRFGFTTRSSQLHES
FT                   RLLRIAGPLFHYGLLFVIAGHVAGLLVPESLTDRLHVSEHLYHANALIAGGTAGLATLA
FT                   GLALLLYRRLRTPAIRAATSRSDRVVYPLLLTVVLAGLTATASGATAASTYDYRLGVSV
FT                   WFRSLFALDPDVTAMAQAPLVYRLHALLAMALFALWPYTRLIHAFTAPLGYLVRPYVVY
FT                   RYRGRGEVGAGRPGR"
     MRHLHTALWG VLPYLTLVVL VAGTAWRYRY DRFGFTTRSS QLHESRLLRI AGPLFHYGLL        60
     FVIAGHVAGL LVPESLTDRL HVSEHLYHAN ALIAGGTAGL ATLAGLALLL YRRLRTPAIR       120
     AATSRSDRVV YPLLLTVVLA GLTATASGAT AASTYDYRLG VSVWFRSLFA LDPDVTAMAQ       180
     APLVYRLHAL LAMALFALWP YTRLIHAFTA PLGYLVRPYV VYRYRGRGEV GAGRPGR          237
//

If you have problems or comments...

PBIL Back to PBIL home page