(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4951

AL939122.SCO4951     Location/Qualifiers
FT   CDS             complement(17898..18935)
FT                   /transl_table=11
FT                   /gene="SCO4951"
FT                   /gene_synonym="2SCK31.11c"
FT                   /product="putative aldoketoreductase"
FT                   /note="2SCK31.11c, probable aldoketoreductase, len: 345 aa;
FT                   similar to TR:Q9XC70 (EMBL:AF147704) Streptomyces fradiae
FT                   NDP-hexose 2,3-enoyl reductase TylCII, 329 aa; fasta
FT                   scores: opt: 726 z-score: 830.3 E(): 0; 41.3% identity in
FT                   320 aa overlap. Contains 2x Pfam matches to entry PF00248
FT                   aldo_ket_red, Aldo/keto reductase family"
FT                   /db_xref="GOA:Q9ADK9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK9"
FT                   /protein_id="CAD30937.1"
FT                   /translation="MQYRTLGRTGVQVSSLALGAMNFGSIGRTTQDEATAIVDAALEGG
FT                   INLIDTADMYGRGESEEMVGKAIAGRRDDIVLATKANMPMSDEPNHQGSSRRWLVTALD
FT                   NSLRRLGVDHVDLYQIHRWDPATSDEETLSALTDLQRAGKIRYFGSSTFPAYRIVEAQW
FT                   AAREHRLSRYVTEQPSYSLLQRGIESHVLPVTEQYGLGVLVWSPLASGWLSGAVRAGRE
FT                   AATHRSAVLPERFDTALPANRARLDAVEKLAAVADEAGLTLIQLALGFVTAHPAVTAAL
FT                   VGPRTLNHLHSQLAAADTVLSDDVLDAVDAVVAPGTDLAAHEKFDATPALLDPALRRRR
FT                   RPAAG"
     MQYRTLGRTG VQVSSLALGA MNFGSIGRTT QDEATAIVDA ALEGGINLID TADMYGRGES        60
     EEMVGKAIAG RRDDIVLATK ANMPMSDEPN HQGSSRRWLV TALDNSLRRL GVDHVDLYQI       120
     HRWDPATSDE ETLSALTDLQ RAGKIRYFGS STFPAYRIVE AQWAAREHRL SRYVTEQPSY       180
     SLLQRGIESH VLPVTEQYGL GVLVWSPLAS GWLSGAVRAG REAATHRSAV LPERFDTALP       240
     ANRARLDAVE KLAAVADEAG LTLIQLALGF VTAHPAVTAA LVGPRTLNHL HSQLAAADTV       300
     LSDDVLDAVD AVVAPGTDLA AHEKFDATPA LLDPALRRRR RPAAG                       345
//

If you have problems or comments...

PBIL Back to PBIL home page