(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4952

AL939122.SCO4952     Location/Qualifiers
FT   CDS             19080..19676
FT                   /transl_table=11
FT                   /gene="SCO4952"
FT                   /gene_synonym="2SCK31.12"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="2SCK31.12, probable tetR-family transcriptional
FT                   regulator, len: 198 aa; similar to TR:Q9RJL5
FT                   (EMBL:AL121849) Streptomyces coelicolor putative
FT                   tetR-family transcriptional regulator SCF6.16, 194 aa;
FT                   fasta scores: opt: 355 z-score: 451.5 E(): 1.3e-17; 35.1%
FT                   identity in 185 aa overlap. Contains Pfam match to entry
FT                   PF00440 tetR, Bacterial regulatory proteins, tetR family
FT                   and possible helix-turn-helix motif at residues 42..63
FT                   (+4.18 SD)"
FT                   /db_xref="GOA:Q9ADK8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK8"
FT                   /protein_id="CAD30938.1"
FT                   /translation="MKDGEAATGQAASRPKRADARRNEKNLLDAAAAVFVRSGVEAPVR
FT                   DIAAEAGVGTATIYRHFPTRADLIIGVYRHQVEACAEAGPALLASSPTPYAALAGWIDL
FT                   FVDFLVTKHGLAAVLQSDSAGFETLHAYFLDRLVPVCTDLLAAATDSGEIDTDVPPLAL
FT                   MRGVGNLCIGAETPNPSYDARQLVRILIAGLRAAD"
     MKDGEAATGQ AASRPKRADA RRNEKNLLDA AAAVFVRSGV EAPVRDIAAE AGVGTATIYR        60
     HFPTRADLII GVYRHQVEAC AEAGPALLAS SPTPYAALAG WIDLFVDFLV TKHGLAAVLQ       120
     SDSAGFETLH AYFLDRLVPV CTDLLAAATD SGEIDTDVPP LALMRGVGNL CIGAETPNPS       180
     YDARQLVRIL IAGLRAAD                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page