(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4953

AL939122.SCO4953     Location/Qualifiers
FT   CDS             19724..19918
FT                   /transl_table=11
FT                   /gene="SCO4953"
FT                   /gene_synonym="2SCK31.13"
FT                   /product="hypothetical protein 2SCK31.13"
FT                   /note="2SCK31.13, unknown, len: 64 aa"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK7"
FT                   /protein_id="CAD30939.1"
FT                   /translation="MLDKFPALTELGQLRVSDGRPHETALVLGSFRRRSNGDWDFVVGG
FT                   KGYSGGLEELLRDFGVEVD"
     MLDKFPALTE LGQLRVSDGR PHETALVLGS FRRRSNGDWD FVVGGKGYSG GLEELLRDFG        60
     VEVD                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page