(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4955

AL939122.SCO4955     Location/Qualifiers
FT   CDS             complement(20665..21852)
FT                   /transl_table=11
FT                   /gene="SCO4955"
FT                   /gene_synonym="2SCK31.15c"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="2SCK31.15c, hypothetical protein, len: 395 aa;
FT                   similar to TR:Q9X8V7 (EMBL:AL078610) Streptomyces
FT                   coelicolor hypothetical 43.9 kDa protein SCH35.49c, 410 aa;
FT                   fasta scores: opt: 1788 z-score: 1973.1 E(): 0; 63.8%
FT                   identity in 398 aa overlap. Contains match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK5"
FT                   /protein_id="CAD30941.1"
FT                   /translation="MGLALAGAGLATVGTAPAAAGSYDCPSGYFCGWTGESANGSMWKT
FT                   NKSVADLGGWDNKIRSYVNRTTSVACVYEDKNYTPWGGYWAQEPNSPGEYNGDPVATTS
FT                   SVKFVRTERECSQPAYPSWSSETSPKALGFGDLNGDRRADVVTRDEAGRLWFSPGDTTG
FT                   RLIGTGGWNAMSALTRHGDFSRDGREDLIAREASTGKLWLYPGTGTGSLGSRKLIGKSG
FT                   WNAMNRVTAFGDLTGDGRSDLIAVEKATARLWLYPGTSTGTLGARKLIGKSGWNAMNAL
FT                   IGMGDVTGDGRPDLYAREASTGKLWLYPGTSTGTLGSRTLVGTGGWNAMAHFLPVGDFS
FT                   GDGVPDLATVTNEKYVLDGYPGNLGWLVTYRGRGNGFLTSGVPTHGEWWGLNGFV"
     MGLALAGAGL ATVGTAPAAA GSYDCPSGYF CGWTGESANG SMWKTNKSVA DLGGWDNKIR        60
     SYVNRTTSVA CVYEDKNYTP WGGYWAQEPN SPGEYNGDPV ATTSSVKFVR TERECSQPAY       120
     PSWSSETSPK ALGFGDLNGD RRADVVTRDE AGRLWFSPGD TTGRLIGTGG WNAMSALTRH       180
     GDFSRDGRED LIAREASTGK LWLYPGTGTG SLGSRKLIGK SGWNAMNRVT AFGDLTGDGR       240
     SDLIAVEKAT ARLWLYPGTS TGTLGARKLI GKSGWNAMNA LIGMGDVTGD GRPDLYAREA       300
     STGKLWLYPG TSTGTLGSRT LVGTGGWNAM AHFLPVGDFS GDGVPDLATV TNEKYVLDGY       360
     PGNLGWLVTY RGRGNGFLTS GVPTHGEWWG LNGFV                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page