(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4957

AL939122.SCO4957     Location/Qualifiers
FT   CDS             complement(22632..23750)
FT                   /transl_table=11
FT                   /gene="SCO4957"
FT                   /gene_synonym="2SCK31.17c"
FT                   /product="putative membrane protein"
FT                   /note="2SCK31.17c, putative membrane protein, len: 372 aa;
FT                   similar to TR:Q9S2T3 (EMBL:AL096884) Streptomyces
FT                   coelicolor hypothetical 40.5 kDa protein SC4G6.25, 376 aa;
FT                   fasta scores: opt: 334 z-score: 393.9 E(): 2.1e-14 34.3%
FT                   identity in 324 aa overlap. Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF8"
FT                   /protein_id="CAD30943.1"
FT                   /translation="MEILWVLMALVMLGFVLLQVSRRRRGAVGLVEPGHPDAADPANYG
FT                   FAREEELDIRMPGPDQDLLDVLDLVQRTQDYRGAMQLLAGTEAEGERRWQRVQAFAGAA
FT                   SLELRQRPGGVGETPGGQWLRVWRAEAPKDAGGAAVHAEFLVQQAWRTSTPGSDDFRII
FT                   MEEARAACGEAALLAPGDPVPYIVELSVARGLGYSREEFEQLWLKILDRAPNHMGAHLA
FT                   ALQYWCEKWHGSRQLAYSFAEAAAARAPRGSLLAAMPLFAVFEHLPEVNLVSGFYQSEV
FT                   VTKAVHGALHAVHSARPDDPMQAHVRHLLVFFLVRGERWAEAMNQLTVIDGHVGALPWT
FT                   LSTDPAAEFAVYRALAVAGYEANGGSPATLPH"
     MEILWVLMAL VMLGFVLLQV SRRRRGAVGL VEPGHPDAAD PANYGFAREE ELDIRMPGPD        60
     QDLLDVLDLV QRTQDYRGAM QLLAGTEAEG ERRWQRVQAF AGAASLELRQ RPGGVGETPG       120
     GQWLRVWRAE APKDAGGAAV HAEFLVQQAW RTSTPGSDDF RIIMEEARAA CGEAALLAPG       180
     DPVPYIVELS VARGLGYSRE EFEQLWLKIL DRAPNHMGAH LAALQYWCEK WHGSRQLAYS       240
     FAEAAAARAP RGSLLAAMPL FAVFEHLPEV NLVSGFYQSE VVTKAVHGAL HAVHSARPDD       300
     PMQAHVRHLL VFFLVRGERW AEAMNQLTVI DGHVGALPWT LSTDPAAEFA VYRALAVAGY       360
     EANGGSPATL PH                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page