(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4959

AL939122.SCO4959     Location/Qualifiers
FT   CDS             complement(25012..25269)
FT                   /transl_table=11
FT                   /gene="SCO4959"
FT                   /gene_synonym="2SCK31.19c"
FT                   /product="putative membrane protein"
FT                   /note="2SCK31.19c, possible membrane protein, len: 85 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q9EWG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG0"
FT                   /protein_id="CAD30945.1"
FT                   /translation="MNRPRREAAARRIMEQSPPRVPADLYAEAVRRGGRMLRRRTAARR
FT                   LMWLLLGAAAVAFTVWALTVQPWVEPPSETTPPVTGWEGW"
     MNRPRREAAA RRIMEQSPPR VPADLYAEAV RRGGRMLRRR TAARRLMWLL LGAAAVAFTV        60
     WALTVQPWVE PPSETTPPVT GWEGW                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page