(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4960

AL939122.SCO4960     Location/Qualifiers
FT   CDS             complement(25316..25822)
FT                   /transl_table=11
FT                   /gene="SCO4960"
FT                   /gene_synonym="2SCK31.20c"
FT                   /product="putative sigma factor"
FT                   /note="2SCK31.20c, possible sigma factor, len: 168 aa;
FT                   similar to SW:RPOE_STRCO (EMBL:L29636) Streptomyces
FT                   coelicolor RNA polymerase sigma-E factor SigE, 176 aa;
FT                   fasta scores: opt: 108 z-score: 140.1 E(): 2.9; 30.8%
FT                   identity in 156 aa overlap"
FT                   /db_xref="GOA:Q9EWG1"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG1"
FT                   /protein_id="CAD30946.1"
FT                   /translation="MRERHASRNARRAREFEAFVAGAAGRLLHAATLLTAEAPDANPRA
FT                   RRLLALSLAHTYADWDRLHGEDPYDRARQHLATRFARAAWHRYGALGRTRRHPAGPLGG
FT                   LAPQERLLLVLRLYEGVAEEQTAALLGLPVERVRTICDRATAALLRPPPSPARPVTADA
FT                   RAATP"
     MRERHASRNA RRAREFEAFV AGAAGRLLHA ATLLTAEAPD ANPRARRLLA LSLAHTYADW        60
     DRLHGEDPYD RARQHLATRF ARAAWHRYGA LGRTRRHPAG PLGGLAPQER LLLVLRLYEG       120
     VAEEQTAALL GLPVERVRTI CDRATAALLR PPPSPARPVT ADARAATP                    168
//

If you have problems or comments...

PBIL Back to PBIL home page