(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4961

AL939122.SCO4961     Location/Qualifiers
FT   CDS             complement(26005..26505)
FT                   /transl_table=11
FT                   /gene="SCO4961"
FT                   /gene_synonym="2SCK31.21c"
FT                   /product="putative marR-family transcriptional regulator"
FT                   /note="2SCK31.21c possible marR-family transcriptional
FT                   regulator, len: 166 aa; similar to SW:YXAD_BACSU
FT                   (EMBL:AB005554) Bacillus subtilis hypothetical
FT                   transcriptional regulator in AsnH-GntR intergenic region
FT                   YxaD, 143 aa; fasta scores: opt: 268 z-score: 338.9 E():
FT                   2.4e-11; 35.0% identity in 137 aa overlap. Contains Pfam
FT                   match to entry PF01047 MarR, MarR family and possible
FT                   helix-turn-helix motif at residues 58..79 (+2.70 SD)"
FT                   /db_xref="GOA:Q9EWG2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG2"
FT                   /protein_id="CAD30947.1"
FT                   /translation="MDMTTAGDTGLLETLQHEVALFARRAEQTRLGGVGQVRNSMDRAA
FT                   YLLLNRLDKEGPMGVKALAASMGIDSSTVTRQVAPLVDTGLVKRTSHPEDGRAVVLQLS
FT                   PRGVARLEEVRSSRRQLMAELTHDWAPQERETFCALLARFNGALSARMAPSGVSPTDAP
FT                   SGS"
     MDMTTAGDTG LLETLQHEVA LFARRAEQTR LGGVGQVRNS MDRAAYLLLN RLDKEGPMGV        60
     KALAASMGID SSTVTRQVAP LVDTGLVKRT SHPEDGRAVV LQLSPRGVAR LEEVRSSRRQ       120
     LMAELTHDWA PQERETFCAL LARFNGALSA RMAPSGVSPT DAPSGS                      166
//

If you have problems or comments...

PBIL Back to PBIL home page