(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4963

AL939122.SCO4963     Location/Qualifiers
FT   CDS             28064..29071
FT                   /transl_table=11
FT                   /gene="SCO4963"
FT                   /gene_synonym="2SCK31.23"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="2SCK31.23, possible ABC transporter ATP-binding
FT                   protein, len: 335 aa; similar to TR:CAC08315
FT                   (EMBL:AL392149) Streptomyces coelicolor putative ABC
FT                   transport system ATP-binding protein SCD19A.14, 336 aa;
FT                   fasta scores: opt: 1211 z-score: 1254.5 E(): 0; 58.2%
FT                   identity in 330 aa overlap. Contains Pfam match to entry
FT                   PF00005 ABC_tran, ABC transporter and match to Prosite
FT                   entry PS00017 ATP/GTP-binding site motif A (P-loop) and
FT                   PS00211 ABC transporters family signature"
FT                   /db_xref="GOA:Q9AD75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AD75"
FT                   /protein_id="CAC21637.3"
FT                   /translation="MPGAIYAEGLVKTFGDVRALDGVDLDVPEGTVLGLLGPNGAGKTT
FT                   AVRCLTTLLRPDSGKAVVAGIDVLRQPNEVRRSIGLSGQFAAVDEYLTGRENLHMVGQL
FT                   YQMKGKAAKARAAELLDQFHLSDAADRPTKTYSGGMRRRLDLAAALVVSPPVMFMDEPT
FT                   TGLDPRNRQELWEVIKQLVAGGTTLLLTTQYLEEADHLAHDIAVVDHGRVIARGTSDQL
FT                   KARTGGERVEVVVHDRGRMATASDVLAGFGKGSTTVEEHTRKLTVPVTGGAKLLAEVIR
FT                   ELDVRGIEIDDIGLRRPTLDDVFLSLTGHVAEAADETNGSADDADHEQEKETAK"
     MPGAIYAEGL VKTFGDVRAL DGVDLDVPEG TVLGLLGPNG AGKTTAVRCL TTLLRPDSGK        60
     AVVAGIDVLR QPNEVRRSIG LSGQFAAVDE YLTGRENLHM VGQLYQMKGK AAKARAAELL       120
     DQFHLSDAAD RPTKTYSGGM RRRLDLAAAL VVSPPVMFMD EPTTGLDPRN RQELWEVIKQ       180
     LVAGGTTLLL TTQYLEEADH LAHDIAVVDH GRVIARGTSD QLKARTGGER VEVVVHDRGR       240
     MATASDVLAG FGKGSTTVEE HTRKLTVPVT GGAKLLAEVI RELDVRGIEI DDIGLRRPTL       300
     DDVFLSLTGH VAEAADETNG SADDADHEQE KETAK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page