(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4965

AL939122.SCO4965     Location/Qualifiers
FT   CDS             complement(30027..30524)
FT                   /transl_table=11
FT                   /gene="SCO4965"
FT                   /gene_synonym="2SCK31.25c"
FT                   /product="putative transcription elongation factor"
FT                   /note="2SCK31.25c, probable transcription elongation
FT                   factor, len: 165 aa; similar to SW:GREA_ECOLI (EMBL:X54718)
FT                   Escherichia coli transcription elongation factor GreA
FT                   (transcript cleavage factor), 158 aa; fasta scores: opt:
FT                   265 z-score: 326.5 E(): 1.2e-10; 34.0% identity in 153 aa
FT                   overlap. Contains Pfam match to entry PF01272 GreA_GreB,
FT                   Prokaryotic transcription elongation factor, GreA/GreB and
FT                   match to Prosite entry PS00830 Prokaryotic transcription
FT                   elongation factors signature 2"
FT                   /db_xref="GOA:Q9ADK2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ADK2"
FT                   /protein_id="CAD30950.1"
FT                   /translation="MTQTSENVTWLTQEAYNKLKEELEYLTGPARTEISAKIAAAREEG
FT                   DLRENGGYHAAKEEQGKQELRVRQLTQLLESAKVGEAPAADGVVAPGMVVTIAFDGDED
FT                   DTLTFLLASREYASSDIETYSPQSPLGSGVLGHKVGDDAQYELPNGKPASVRILKAEPY
FT                   NG"
     MTQTSENVTW LTQEAYNKLK EELEYLTGPA RTEISAKIAA AREEGDLREN GGYHAAKEEQ        60
     GKQELRVRQL TQLLESAKVG EAPAADGVVA PGMVVTIAFD GDEDDTLTFL LASREYASSD       120
     IETYSPQSPL GSGVLGHKVG DDAQYELPNG KPASVRILKA EPYNG                       165
//

If you have problems or comments...

PBIL Back to PBIL home page