(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4968

AL939122.SCO4968     Location/Qualifiers
FT   CDS             32117..32344
FT                   /transl_table=11
FT                   /gene="SCO4968"
FT                   /gene_synonym="2SCK31.28"
FT                   /product="putative membrane protein"
FT                   /note="2SCK31.28, possible membrane protein, len: 75 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q9EWG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG4"
FT                   /protein_id="CAD30953.1"
FT                   /translation="MSASASLAMTHLVTLAELDEDKVTPGVLGFIVFAVMALAVWGLMK
FT                   SMNRHMGKVDFKEPAEQDASAGPEAKPQRG"
     MSASASLAMT HLVTLAELDE DKVTPGVLGF IVFAVMALAV WGLMKSMNRH MGKVDFKEPA        60
     EQDASAGPEA KPQRG                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page