(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4969

AL939122.SCO4969     Location/Qualifiers
FT   CDS             complement(32381..35884)
FT                   /transl_table=11
FT                   /gene="SCO4969"
FT                   /gene_synonym="2SCK31.29c"
FT                   /product="putative regulatory protein"
FT                   /note="2SCK31.29c, possible regulatory protein, len: 1167
FT                   aa; similar in its middle domain to SW:AFSR_STRCO
FT                   (EMBL:D90155) Streptomyces coelicolor regulatory protein
FT                   AfsR, 993 aa; fasta scores: opt: 298 z-score: 279.4 E():
FT                   5e-08; 28.9% identity in 806 aa overlap. Contains 5x Pfam
FT                   matches to entry PF00515 TPR, TPR Domain"
FT                   /db_xref="GOA:Q9EWG5"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG5"
FT                   /protein_id="CAD30954.1"
FT                   /translation="MGLLPSQISGCGHRGQERNSSIFPAGADPPPQGLLVAGHLTRAQP
FT                   GKDPGMGRKGPWDAWGHGGARGDPAGHRCRRRGRDMRDSHRAEAEGLLRRAVEEEVRRS
FT                   GGRTDGNVLLSRARAALDAMAGTAGEEYSAYTHALDEAAAGQLTFRQRYAREGAGTPLL
FT                   VAAVAAVAAAVADVALGTGTGTAVGAGVTVGVVGAAATVVKVVGAHVPAAHHRAGAVSQ
FT                   PGGPEQLRLQWLTALEVRGIRPFLDQQRMLAASTGPAKTGPKLRGADKSAAARGRSALE
FT                   QSFGQLPEPGDAFAGRRAEMARLRQWVQAARASTETKPTVVVLHGAPGSGRTTLAVRAV
FT                   HELRDYFRGACLVDLRGAGSAAGGSTAGGGGSGGPGPAGSVEGGESPLSTRDALLHLLN
FT                   RLGAPREQLLFRERSSADQQVKRLSELYHQHLTGVPVTVVLDDASDPEQVCTLVPERSD
FT                   SLVLVTARQALRLPPDLPARVYDLPVEALDAAGAEELLGAAAEDASGPYDAESSEQIRQ
FT                   LCGGLPLALRVAGSSLGPRSPRALATDLAAYGPVEPVERALWLRYTDQSEPARRLLRRL
FT                   ALAGRTSLGAAAAAALLATDETEANRQLAALSRAGLLDHVRGSRYRLHDVVRAFARARL
FT                   ADEEEPGERTAAQERLIANYAELADSVLRLVDGNMSTRSNQFGQYGFTSLDEALRWLDD
FT                   ESSFITATLRHAEGVDQGTVLNLLGALCDYCLLRGDLYRLGEISELAQSVDQGLLVRSV
FT                   QWRTGIAARQLGELDKARTTLASVVDLYRDAHHDAGAARALCSLGITLHHQGNLTDAAA
FT                   KLQEALGLQAAPELATDRAWTLHALAAVQRDRARLAEALELLTESLVLHRAGESVHGQA
FT                   WAHFQLGQLHLRMGDVPGAESDLRVALDLYGRTQDARGEAWALTQLARARLVDGDVSAA
FT                   VEGLRRAETRHRENADARGKAWSIYYLGQALEETGALDQSVRALERSRTMFSRMRDVYG
FT                   LACARHHSARVTRDQRAAQTGSLRNSGFARQLLVDARADFQRIGVGHGEAWTCLELAVV
FT                   DAGNARTPQALALCDEAAALFAGYGDRRGEDWARFLRCTLLPYAAPGGVEIGTAVAQEE
FT                   LTQLSRARHPARDTKLDDYVDAYQLLLERGVQLEAGWQAWRLGMVPGRQAREVMGVAVT
FT                   A"
     MGLLPSQISG CGHRGQERNS SIFPAGADPP PQGLLVAGHL TRAQPGKDPG MGRKGPWDAW        60
     GHGGARGDPA GHRCRRRGRD MRDSHRAEAE GLLRRAVEEE VRRSGGRTDG NVLLSRARAA       120
     LDAMAGTAGE EYSAYTHALD EAAAGQLTFR QRYAREGAGT PLLVAAVAAV AAAVADVALG       180
     TGTGTAVGAG VTVGVVGAAA TVVKVVGAHV PAAHHRAGAV SQPGGPEQLR LQWLTALEVR       240
     GIRPFLDQQR MLAASTGPAK TGPKLRGADK SAAARGRSAL EQSFGQLPEP GDAFAGRRAE       300
     MARLRQWVQA ARASTETKPT VVVLHGAPGS GRTTLAVRAV HELRDYFRGA CLVDLRGAGS       360
     AAGGSTAGGG GSGGPGPAGS VEGGESPLST RDALLHLLNR LGAPREQLLF RERSSADQQV       420
     KRLSELYHQH LTGVPVTVVL DDASDPEQVC TLVPERSDSL VLVTARQALR LPPDLPARVY       480
     DLPVEALDAA GAEELLGAAA EDASGPYDAE SSEQIRQLCG GLPLALRVAG SSLGPRSPRA       540
     LATDLAAYGP VEPVERALWL RYTDQSEPAR RLLRRLALAG RTSLGAAAAA ALLATDETEA       600
     NRQLAALSRA GLLDHVRGSR YRLHDVVRAF ARARLADEEE PGERTAAQER LIANYAELAD       660
     SVLRLVDGNM STRSNQFGQY GFTSLDEALR WLDDESSFIT ATLRHAEGVD QGTVLNLLGA       720
     LCDYCLLRGD LYRLGEISEL AQSVDQGLLV RSVQWRTGIA ARQLGELDKA RTTLASVVDL       780
     YRDAHHDAGA ARALCSLGIT LHHQGNLTDA AAKLQEALGL QAAPELATDR AWTLHALAAV       840
     QRDRARLAEA LELLTESLVL HRAGESVHGQ AWAHFQLGQL HLRMGDVPGA ESDLRVALDL       900
     YGRTQDARGE AWALTQLARA RLVDGDVSAA VEGLRRAETR HRENADARGK AWSIYYLGQA       960
     LEETGALDQS VRALERSRTM FSRMRDVYGL ACARHHSARV TRDQRAAQTG SLRNSGFARQ      1020
     LLVDARADFQ RIGVGHGEAW TCLELAVVDA GNARTPQALA LCDEAAALFA GYGDRRGEDW      1080
     ARFLRCTLLP YAAPGGVEIG TAVAQEELTQ LSRARHPARD TKLDDYVDAY QLLLERGVQL      1140
     EAGWQAWRLG MVPGRQAREV MGVAVTA                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page