(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4970

AL939122.SCO4970     Location/Qualifiers
FT   CDS             complement(35887..36039)
FT                   /transl_table=11
FT                   /gene="SCO4970"
FT                   /gene_synonym="2SCK31.30c"
FT                   /product="hypothetical protein 2SCK31.30c"
FT                   /note="2SCK31.30c, unknown, len: 50 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG6"
FT                   /protein_id="CAD30955.1"
FT                   /translation="MKEKPGMCHTGAQRNGVSAAVRDPARNPHGAAGEATQVRVGAHLP
FT                   VASCR"
     MKEKPGMCHT GAQRNGVSAA VRDPARNPHG AAGEATQVRV GAHLPVASCR                   50
//

If you have problems or comments...

PBIL Back to PBIL home page