(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4971

AL939122.SCO4971     Location/Qualifiers
FT   CDS             36195..37688
FT                   /transl_table=11
FT                   /gene="SCO4971"
FT                   /gene_synonym="2SCK31.31"
FT                   /product="putative dehydrogenase"
FT                   /note="2SCK31.31, possible dehydrogenase, len: 497 aa;
FT                   similar to N-terminal domain of SW:XDH_MOUSE (EMBL:X75129)
FT                   Mus musculus xanthine dehydrogenase/oxidase Xdh, 1335 aa;
FT                   fasta scores: opt: 345 z-score: 361.7 E(): 1.3e-12 31.5%
FT                   identity in 483 aa overlap and to TR:O54050 (EMBL:AJ001013)
FT                   Rhodobacter capsulatus xanthine dehydrogenase (EC
FT                   1.1.1.204) XdhA, 462 aa; fasta scores: opt: 631 z-score:
FT                   669.1 E(): 9.8e-30; 38.2% identity in 495 aa overlap.
FT                   Contains Pfam matches to entries PF00111 fer2, 2Fe-2S
FT                   iron-sulfur cluster binding domains, PF01799 fer2_2,
FT                   [2Fe-2S] binding domain and PF00941 dehydrog_molyb,
FT                   Molybdopterin binding domain in dehydrogenase and match to
FT                   Prosite entry PS00197 2Fe-2S ferredoxins, iron-sulfur
FT                   binding region signature"
FT                   /db_xref="GOA:Q9EWG7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG7"
FT                   /protein_id="CAD30956.1"
FT                   /translation="MVTARITVNGKESPIAPAAPHTTVLDFLRERGLTGTKEGCAEGEC
FT                   GACSVLVARPGVNKPTDWVPVNACLVPVAALDGQEVVTSEGLATVEAPGTPPVLHPVQE
FT                   EMAVRGGSQCGYCTPGFVCSMAAEYYRPDRCAHADPGPDATAAADGAEGGDAEHGPNGF
FT                   DLHALSGNLCRCTGYRPIRDAAFAVGTPTDEDPLARRREQDPPAPVATEYRQDDSAFLR
FT                   RSTLAETLRLLRERPQAVVVAGSTDWGVEVNIRSRRADCVVAVDRLPELRDLRVESDHV
FT                   EIGAALTLTEIERRLDGSVPLLAQLFPQFASRLIRNGATLGGNLGTGSPIGDSPPVLLA
FT                   LEASLVLADADGEREVPLADYFTGYRQSVRRPGELIRAVRVPLPLSPVTAFHKIAKRRF
FT                   DDISSLAVAFALDVEGGTVRKARIGLGGVAATPVRALATEAALEGRPWTTGTAEAAAEV
FT                   LRGEGTPMSDHRASARYRAAMLGQSLLKLYAQTTEAVPS"
     MVTARITVNG KESPIAPAAP HTTVLDFLRE RGLTGTKEGC AEGECGACSV LVARPGVNKP        60
     TDWVPVNACL VPVAALDGQE VVTSEGLATV EAPGTPPVLH PVQEEMAVRG GSQCGYCTPG       120
     FVCSMAAEYY RPDRCAHADP GPDATAAADG AEGGDAEHGP NGFDLHALSG NLCRCTGYRP       180
     IRDAAFAVGT PTDEDPLARR REQDPPAPVA TEYRQDDSAF LRRSTLAETL RLLRERPQAV       240
     VVAGSTDWGV EVNIRSRRAD CVVAVDRLPE LRDLRVESDH VEIGAALTLT EIERRLDGSV       300
     PLLAQLFPQF ASRLIRNGAT LGGNLGTGSP IGDSPPVLLA LEASLVLADA DGEREVPLAD       360
     YFTGYRQSVR RPGELIRAVR VPLPLSPVTA FHKIAKRRFD DISSLAVAFA LDVEGGTVRK       420
     ARIGLGGVAA TPVRALATEA ALEGRPWTTG TAEAAAEVLR GEGTPMSDHR ASARYRAAML       480
     GQSLLKLYAQ TTEAVPS                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page