(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4972

AL939122.SCO4972     Location/Qualifiers
FT   CDS             37685..40105
FT                   /transl_table=11
FT                   /gene="SCO4972"
FT                   /gene_synonym="2SCK31.32"
FT                   /product="putative dehydrogenase"
FT                   /note="2SCK31.32, possible dehydrogenase, len: 806 aa;
FT                   similar to the C-terminal region of SW:XDH_MOUSE
FT                   (EMBL:X75129) Mus musculus xanthine dehydrogenase/oxidase
FT                   Xdh, 1335 aa; fasta scores: opt: 1456 z-score: 1610.8 E():
FT                   0; 43.3% identity in 767 aa overlap. Contains Pfam match to
FT                   entry PF01315 Ald_Xan_dh_C, Aldehyde oxidase and xanthine
FT                   dehydrogenase, C terminus"
FT                   /db_xref="GOA:Q9EWG8"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG8"
FT                   /protein_id="CAD30957.1"
FT                   /translation="MSHLSERPEKPVVGVSMPHESAVQHVTGAALYTDDLVQRTKDVLH
FT                   AYPVQVMKARGRVTALRTGAALAVPGVVRVLTGADVPGVNDAGMKHDEPLFPDEVMFHG
FT                   HAVAWVLGETLEAARIGAAAVEVDLEELPSVITLQDAIAADSYHGARPVMTHGDVDAGF
FT                   ADSAHVFTGEFQFSGQEHFYLETHAALAQVDENGQVFIQSSTQHPSETQEIVSHVLGVP
FT                   AHEVTVQCLRMGGGFGGKEMQPHGFAAIAALGAKLTGRPVRFRLNRTQDLTMSGKRHGF
FT                   HATWKIGFDTEGRIQALDATLTADGGWSLDLSEPVLARALCHIDNTYWIPNARVAGRIA
FT                   RTNTVSNTAFRGFGGPQGMLVIEDILGRCAPRLGVDAKELRERNFYRPGQGQTTPYGQP
FT                   VTQPERIAAVWQQVQDNGHIADREREIAAFNAAHPHTKRALAVTGVKFGISFNLTAFNQ
FT                   GGALVLIYKDGSVLINHGGTEMGQGLHTKMLQVAATTLGIPLHKVRLAPTRTDKVPNTS
FT                   ATAASSGADLNGGAVKNACEQLRERLLRVAASQLGTNASDVRIVEGVARSLGSDQELAW
FT                   DDLVRTAYFQRVQLSAAGYYRTEGLHWDAKSFRGSPFKYFAIGAAATEVEVDGFTGAYR
FT                   IRRVDIVHDVGDSLSPLIDIGQVEGGFVQGAGWLTLEDLRWDTGDGPNRGRLLTQAAST
FT                   YKLPSFSEMPEEFNVTLLENATEEGAVFGSKAVGEPPLMLAFSVREALRQAAAAFGPRG
FT                   TAVELASPATPEAVYWAIESARQGGTAGDGRTHGAAASDAVAVRTGVEALSGA"
     MSHLSERPEK PVVGVSMPHE SAVQHVTGAA LYTDDLVQRT KDVLHAYPVQ VMKARGRVTA        60
     LRTGAALAVP GVVRVLTGAD VPGVNDAGMK HDEPLFPDEV MFHGHAVAWV LGETLEAARI       120
     GAAAVEVDLE ELPSVITLQD AIAADSYHGA RPVMTHGDVD AGFADSAHVF TGEFQFSGQE       180
     HFYLETHAAL AQVDENGQVF IQSSTQHPSE TQEIVSHVLG VPAHEVTVQC LRMGGGFGGK       240
     EMQPHGFAAI AALGAKLTGR PVRFRLNRTQ DLTMSGKRHG FHATWKIGFD TEGRIQALDA       300
     TLTADGGWSL DLSEPVLARA LCHIDNTYWI PNARVAGRIA RTNTVSNTAF RGFGGPQGML       360
     VIEDILGRCA PRLGVDAKEL RERNFYRPGQ GQTTPYGQPV TQPERIAAVW QQVQDNGHIA       420
     DREREIAAFN AAHPHTKRAL AVTGVKFGIS FNLTAFNQGG ALVLIYKDGS VLINHGGTEM       480
     GQGLHTKMLQ VAATTLGIPL HKVRLAPTRT DKVPNTSATA ASSGADLNGG AVKNACEQLR       540
     ERLLRVAASQ LGTNASDVRI VEGVARSLGS DQELAWDDLV RTAYFQRVQL SAAGYYRTEG       600
     LHWDAKSFRG SPFKYFAIGA AATEVEVDGF TGAYRIRRVD IVHDVGDSLS PLIDIGQVEG       660
     GFVQGAGWLT LEDLRWDTGD GPNRGRLLTQ AASTYKLPSF SEMPEEFNVT LLENATEEGA       720
     VFGSKAVGEP PLMLAFSVRE ALRQAAAAFG PRGTAVELAS PATPEAVYWA IESARQGGTA       780
     GDGRTHGAAA SDAVAVRTGV EALSGA                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page