(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4974

AL939122.SCO4974     Location/Qualifiers
FT   CDS             41121..41624
FT                   /transl_table=11
FT                   /gene="SCO4974"
FT                   /gene_synonym="2SCK31.34"
FT                   /product="putative deaminase"
FT                   /note="2SCK31.34, possible deaminase, len: 167 aa; similar
FT                   to TR:AAG05887 (EMBL:AE004677) Pseudomonas aeruginosa
FT                   probable deaminase PA2499, 151 aa; fasta scores: opt: 299
FT                   z-score: 372.9 E(): 3.1e-13; 36.6% identity in 123 aa
FT                   overlap. Contains Pfam match to entry PF00383
FT                   dCMP_cyt_deam, Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="GOA:Q9ADJ9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADJ9"
FT                   /protein_id="CAD30959.1"
FT                   /translation="MTTDTLETGIREFERAWMDKAIELATTSVRNGGGPFGALIAKGGE
FT                   IVALGNNQVTAGLDPTAHAEVSAIRAACKALDTFSLEGCTLVTSCEPCPMCLSSALWAR
FT                   VDRLVFSADRHDAAVAGFDDRKFYDLFEKRPQANWPMTVEHLDLPHRTQPFDAWIAKTD
FT                   RVDY"
     MTTDTLETGI REFERAWMDK AIELATTSVR NGGGPFGALI AKGGEIVALG NNQVTAGLDP        60
     TAHAEVSAIR AACKALDTFS LEGCTLVTSC EPCPMCLSSA LWARVDRLVF SADRHDAAVA       120
     GFDDRKFYDL FEKRPQANWP MTVEHLDLPH RTQPFDAWIA KTDRVDY                     167
//

If you have problems or comments...

PBIL Back to PBIL home page