(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4976

AL939122.SCO4976     Location/Qualifiers
FT   CDS             complement(43773..44501)
FT                   /transl_table=11
FT                   /gene="SCO4976"
FT                   /gene_synonym="2SCK31.36c"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.36c, conserved hypothetical protein, len: 242
FT                   aa; similar to TR:O53776 (EMBL:AL021942) Mycobacterium
FT                   tuberculosis hypothetical 28.5 kDa protein MTV039.17, 252
FT                   aa; fasta scores: opt: 509 z-score: 573.9 E(): 2e-24; 42.3%
FT                   identity in 241 aa overlap. Contains Pfam match to entry
FT                   PF01927 DUF82, Protein of unknown function DUF82"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWH1"
FT                   /protein_id="CAD30961.1"
FT                   /translation="MNGPEIHVEFAPELHLFVPRARPTGVASAATDGVSTLGHLVESLG
FT                   VPLTEVGALLVDGREVPPGHIPAGGESVRVRPVRHPQRVPGAPLRFLLDVHLGTLARRL
FT                   RLLGVDTAYESTDLGDPALAALSAAEKRVLLSRDRGLLRRRELWAGAYVYSTRPEEQLQ
FT                   EVLDRFRPALSPWTRCTACNGLLRTATKEEVAEQLEGGTRRSYDVFAQCTACGRAYWRG
FT                   AHHEQLEAIVERAVSSTRDA"
     MNGPEIHVEF APELHLFVPR ARPTGVASAA TDGVSTLGHL VESLGVPLTE VGALLVDGRE        60
     VPPGHIPAGG ESVRVRPVRH PQRVPGAPLR FLLDVHLGTL ARRLRLLGVD TAYESTDLGD       120
     PALAALSAAE KRVLLSRDRG LLRRRELWAG AYVYSTRPEE QLQEVLDRFR PALSPWTRCT       180
     ACNGLLRTAT KEEVAEQLEG GTRRSYDVFA QCTACGRAYW RGAHHEQLEA IVERAVSSTR       240
     DA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page