(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4977

AL939122.SCO4977     Location/Qualifiers
FT   CDS             complement(44535..45242)
FT                   /transl_table=11
FT                   /gene="SCO4977"
FT                   /gene_synonym="2SCK31.37c"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="2SCK31.37c, probable tetR-family transcriptional
FT                   regulator, len: 235 aa; similar to SW:TCMR_STRGA
FT                   (EMBL:M80674) Streptomyces glaucescens tetracenomycin C
FT                   transcriptional repressor TcmR, 226 aa; fasta scores: opt:
FT                   304 z-score: 354.3 E(): 3.4e-12; 37.2% identity in 218 aa
FT                   overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 46..67 (+5.26 SD)"
FT                   /db_xref="GOA:Q9EWH2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="PDB:2OF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWH2"
FT                   /protein_id="CAD30962.1"
FT                   /translation="MTAARSAPSPAGAPRPGLRERKKTRTREAIRAATYGLIRQQGYEA
FT                   TTVEQIAERAEVSPSTVLRYFPTREDIVLTDEYDPVMAAELAARPAGEPWSDSLRHVLR
FT                   KALGLGAGEEAELIRLRTRLLAEVPAVRARMLENMSDTGRMLARAIADRTGLDPDGLEV
FT                   RIVSMSLVGGLMEVSRYWAEHDHEESLAELVDRALDALENGLPALRESDRESDREGDRG
FT                   GHREDRREGPRKD"
     MTAARSAPSP AGAPRPGLRE RKKTRTREAI RAATYGLIRQ QGYEATTVEQ IAERAEVSPS        60
     TVLRYFPTRE DIVLTDEYDP VMAAELAARP AGEPWSDSLR HVLRKALGLG AGEEAELIRL       120
     RTRLLAEVPA VRARMLENMS DTGRMLARAI ADRTGLDPDG LEVRIVSMSL VGGLMEVSRY       180
     WAEHDHEESL AELVDRALDA LENGLPALRE SDRESDREGD RGGHREDRRE GPRKD            235
//

If you have problems or comments...

PBIL Back to PBIL home page