(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4978

AL939122.SCO4978     Location/Qualifiers
FT   CDS             complement(45297..46001)
FT                   /transl_table=11
FT                   /gene="SCO4978"
FT                   /gene_synonym="2SCK36.01c"
FT                   /product="putative integral membrane protein"
FT                   /note="2SCK36.01c, conserved hypothetical membrane protein,
FT                   len: 234 aa; similar to SW:YA85_MYCTU (EMBL:AL021897)
FT                   Mycobacterium tuberculosis hypothetical 26.0 kDa protein
FT                   RV1085c or MTV017.38c, 242 aa; fasta scores: opt: 563
FT                   Z-score: 653.6 bits: 128.3 E(): 8.6e-29; 39.524% identity
FT                   in 210 aa overlap. Contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q93JL6"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL6"
FT                   /protein_id="CAC40591.1"
FT                   /translation="MTASVPDAPRDLPAGGRGPVTLSLPHPVKPKLRGWLHLGMFPAVL
FT                   VAGLVLTALAETSEARIACGVYVLTACLLFGVSALYHRGDWSPRMDGVLRRLDHANIFL
FT                   IIAGTYTPLTMLLLPGAKGEWLLWGIWAAAAAGIVFRVFWVGAPRWLYTPCYLAMGWAA
FT                   VFYLPEFMRAGGVAVLVLVIVGGLLYSAGGVIYGLKRPNPSPRWFGFHEVFHSFTLAAF
FT                   IAHYVGISLVAY"
     MTASVPDAPR DLPAGGRGPV TLSLPHPVKP KLRGWLHLGM FPAVLVAGLV LTALAETSEA        60
     RIACGVYVLT ACLLFGVSAL YHRGDWSPRM DGVLRRLDHA NIFLIIAGTY TPLTMLLLPG       120
     AKGEWLLWGI WAAAAAGIVF RVFWVGAPRW LYTPCYLAMG WAAVFYLPEF MRAGGVAVLV       180
     LVIVGGLLYS AGGVIYGLKR PNPSPRWFGF HEVFHSFTLA AFIAHYVGIS LVAY             234
//

If you have problems or comments...

PBIL Back to PBIL home page