(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4980

AL939122.SCO4980     Location/Qualifiers
FT   CDS             complement(48400..49350)
FT                   /transl_table=11
FT                   /gene="SCO4980"
FT                   /gene_synonym="2SCK36.03c"
FT                   /product="hypothetical protein 2SCK36.03c"
FT                   /note="2SCK36.03c, unknown, len: 316 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL4"
FT                   /protein_id="CAC40593.1"
FT                   /translation="MSGDGLEGLLAAVHRLTAQRMGPPVCGTAGHGTGHVCLVPPAGAG
FT                   LPGIEEAIGSRFGEPLRLVTGTTTEAAGGSAGLPLRTPFGERIVEMRAWAYGDRWIGCG
FT                   TVRADDADGAVRPVVLVAERADPAAGASAPATWVDGIVAVTGWETARARAVDWPAVEAR
FT                   LGTPLPGDYKRLVEIFGGAGAFDGYLQLQVPDAHDRSTDLVRHTEWLGEWARTHGSRLW
FT                   EPYPVYPAPGGLLQWASTEQADGFYWLTGDPDPDRWPVLAKEDVPDSWERFDGPTGEFV
FT                   HRMLTEPDHPFSTARWFDVHWYQDYGPAAADEGRV"
     MSGDGLEGLL AAVHRLTAQR MGPPVCGTAG HGTGHVCLVP PAGAGLPGIE EAIGSRFGEP        60
     LRLVTGTTTE AAGGSAGLPL RTPFGERIVE MRAWAYGDRW IGCGTVRADD ADGAVRPVVL       120
     VAERADPAAG ASAPATWVDG IVAVTGWETA RARAVDWPAV EARLGTPLPG DYKRLVEIFG       180
     GAGAFDGYLQ LQVPDAHDRS TDLVRHTEWL GEWARTHGSR LWEPYPVYPA PGGLLQWAST       240
     EQADGFYWLT GDPDPDRWPV LAKEDVPDSW ERFDGPTGEF VHRMLTEPDH PFSTARWFDV       300
     HWYQDYGPAA ADEGRV                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page