(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4982

AL939122.SCO4982     Location/Qualifiers
FT   CDS             50938..51120
FT                   /transl_table=11
FT                   /gene="SCO4982"
FT                   /gene_synonym="2SCK36.05"
FT                   /product="putative membrane protein"
FT                   /note="2SCK36.05, putative membrane protein, len: 60 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q93JL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL2"
FT                   /protein_id="CAC40595.1"
FT                   /translation="MADGGDFYSRDRPREPDPQLREDRPRGGGPEDPHQRGNWPVWAIV
FT                   LAIILVFVVLTVIFG"
     MADGGDFYSR DRPREPDPQL REDRPRGGGP EDPHQRGNWP VWAIVLAIIL VFVVLTVIFG        60
//

If you have problems or comments...

PBIL Back to PBIL home page