(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4983

AL939122.SCO4983     Location/Qualifiers
FT   CDS             complement(51206..51628)
FT                   /transl_table=11
FT                   /gene="SCO4983"
FT                   /gene_synonym="2SCK36.06c"
FT                   /product="hypothetical protein 2SCK36.06c"
FT                   /note="2SCK36.06c, unknown, len: 140 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL1"
FT                   /protein_id="CAC40596.1"
FT                   /translation="MYEPIRSKSVHSTMAGTTTDFPGRSRDDELDIQLAGHLAALLAVT
FT                   DELRALAPDTGLDAAAERLAEQVTRLRGGQAPVRLQVAATRQEPRPAALHRRAHTLAAR
FT                   ALVVAASRADTAVAILTAERMDAHSAALEPRPLASR"
     MYEPIRSKSV HSTMAGTTTD FPGRSRDDEL DIQLAGHLAA LLAVTDELRA LAPDTGLDAA        60
     AERLAEQVTR LRGGQAPVRL QVAATRQEPR PAALHRRAHT LAARALVVAA SRADTAVAIL       120
     TAERMDAHSA ALEPRPLASR                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page