(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4985

AL939122.SCO4985     Location/Qualifiers
FT   CDS             53145..53999
FT                   /transl_table=11
FT                   /gene="SCO4985"
FT                   /gene_synonym="2SCK36.08"
FT                   /product="hypothetical protein 2SCK36.08"
FT                   /note="2SCK36.08, unknown, len: 284 aa"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK9"
FT                   /protein_id="CAC40598.1"
FT                   /translation="MNKPLLAALATLAVTGVGVAPAAASPAAPAASASPAAPAVRAVSF
FT                   AGTVALSNCSGSVVRLPASEDDDPALVMSNGHCLETGFPAAGEVVVDQPSSRTFGLLNA
FT                   SGTRVGTLRAGKIAYATMTDTDVSLYQLTSTYAQIRGSYGISPLTLDDTRPTAGTAITV
FT                   VSGYWKRTYACNVDGFAYRLKEGEWTWKDSVRYTSACRTIGGTSGSPVVDNATGKVVAV
FT                   NNTGNEDGGRCTDNNPCEVAEDGTVTVREGINYGQQTYRIPACFALDNKLDLSRSGCAL
FT                   PKP"
     MNKPLLAALA TLAVTGVGVA PAAASPAAPA ASASPAAPAV RAVSFAGTVA LSNCSGSVVR        60
     LPASEDDDPA LVMSNGHCLE TGFPAAGEVV VDQPSSRTFG LLNASGTRVG TLRAGKIAYA       120
     TMTDTDVSLY QLTSTYAQIR GSYGISPLTL DDTRPTAGTA ITVVSGYWKR TYACNVDGFA       180
     YRLKEGEWTW KDSVRYTSAC RTIGGTSGSP VVDNATGKVV AVNNTGNEDG GRCTDNNPCE       240
     VAEDGTVTVR EGINYGQQTY RIPACFALDN KLDLSRSGCA LPKP                        284
//

If you have problems or comments...

PBIL Back to PBIL home page