(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4986

AL939122.SCO4986     Location/Qualifiers
FT   CDS             complement(54037..55647)
FT                   /transl_table=11
FT                   /gene="SCO4986"
FT                   /gene_synonym="2SCK36.09c"
FT                   /product="putative D-aminoacylase"
FT                   /note="2SCK36.09c, probable D-aminoacylase, len: 536 aa;
FT                   similar to SW:NDAD_ALCXX (EMBL:S80683) Alcaligenes
FT                   xylosoxydans D-aminoacylase (EC 3.5.1.81) Dan, 483 aa;
FT                   fasta scores: opt: 370 Z-score: 413.6 bits: 86.1 E():
FT                   2e-15; 33.647% identity in 532 aa overlap"
FT                   /db_xref="GOA:Q93JK8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK8"
FT                   /protein_id="CAC40599.1"
FT                   /translation="MEELVIRDADVVDGSGGDSYRADVVVDGGRIVSIVKEAAAAGCQR
FT                   PEARRELDAEGLVLSPGFIDMHAHSDLALLRDPDHSAKAAQGVTLEVIGQDGLSYAPVD
FT                   DRTLGEVRRAIAGWNGHGDDVDFDWRSVGEYLDRLDRGIAVNAAYLIPQGTVRALAVGW
FT                   DDREATEAELEHMRRLVAEGLEQGAVGLSSGLTYTPGMYAKDAELTELCRVVASYGGYY
FT                   CPHHRSYGAGALKAYEEMVELTREAGCPLHLAHATMNFGVNKGKAPELLTLLDEALAGG
FT                   ADITLDTYPYTPGCTTLVALLPSWASEGGPEQILKRLADDDTAERIRHHMEVIGSDGSH
FT                   GVPMEWETIEISGTGDPALAEYVGRTVLESARLRGESPWTVARHLLLADRLAPTILQHV
FT                   GHEENVRAIMRHRVHTGGSDGILQGAKPHPRAYGTFPHYLGHYVRELGVLPLEECVAHL
FT                   TSRPAARLRLPDRGLVREGYRADLVLFDPATVAAGSSFDEPRVLPTGIPYVLVDGRFVM
FT                   EDGRRTDVLAGRSVRRVPR"
     MEELVIRDAD VVDGSGGDSY RADVVVDGGR IVSIVKEAAA AGCQRPEARR ELDAEGLVLS        60
     PGFIDMHAHS DLALLRDPDH SAKAAQGVTL EVIGQDGLSY APVDDRTLGE VRRAIAGWNG       120
     HGDDVDFDWR SVGEYLDRLD RGIAVNAAYL IPQGTVRALA VGWDDREATE AELEHMRRLV       180
     AEGLEQGAVG LSSGLTYTPG MYAKDAELTE LCRVVASYGG YYCPHHRSYG AGALKAYEEM       240
     VELTREAGCP LHLAHATMNF GVNKGKAPEL LTLLDEALAG GADITLDTYP YTPGCTTLVA       300
     LLPSWASEGG PEQILKRLAD DDTAERIRHH MEVIGSDGSH GVPMEWETIE ISGTGDPALA       360
     EYVGRTVLES ARLRGESPWT VARHLLLADR LAPTILQHVG HEENVRAIMR HRVHTGGSDG       420
     ILQGAKPHPR AYGTFPHYLG HYVRELGVLP LEECVAHLTS RPAARLRLPD RGLVREGYRA       480
     DLVLFDPATV AAGSSFDEPR VLPTGIPYVL VDGRFVMEDG RRTDVLAGRS VRRVPR           536
//

If you have problems or comments...

PBIL Back to PBIL home page