(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4987

AL939122.SCO4987     Location/Qualifiers
FT   CDS             complement(55676..56977)
FT                   /transl_table=11
FT                   /gene="SCO4987"
FT                   /gene_synonym="2SCK36.10c"
FT                   /product="putative D-amino acid deaminase"
FT                   /note="2SCK36.10c, possible D-amino acid deaminase, len:
FT                   433 aa; similar to TR:Q45085 (EMBL:AF158699) Burkholderia
FT                   cepacia D-serine deaminase Dsd, 432 aa; fasta scores: opt:
FT                   919 Z-score: 1026.2 bits: 199.0 E(): 1.5e-49; 41.259%
FT                   identity in 429 aa overlap. Contains match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK7"
FT                   /protein_id="CAC40600.1"
FT                   /translation="MALDNGPAGGREALAELAEERVDHRFKGLPPDAYGLTLAELAGQR
FT                   RNLFTGGFTTPVLALSAERLEHNLKLMETYSARHGLAFAPHGKTSMAPQLFHRQIEHGA
FT                   WGITLAVPHQVRVARAFGVQRVFLANELVDAAALRWISAELDADPGFRFVCYADSVRGV
FT                   ELMDAALTDAGAARPLDVVVELAAGAGARTGVRTEAGCAAVADAVAGARTLRLAGVAGY
FT                   EGEVPDADPERVHAWLRRLVALAVDFDRAGRFDGLEEIVLSAGGSAWFDAVADVFAEVP
FT                   GLSLPVLKLLRSGAYVSHDDGHYRELTPFNRVPEEGALEPAFRLWSQVVSRPSPEQAFT
FT                   NAGKRDAAYDLHLPFAQVVRPADGGPERPATGVEVTGLSDQHAWLRTSGEADLAVGDWV
FT                   GAGLSHPCTSFDKWQLIPVAQADGTVVDYIRTFF"
     MALDNGPAGG REALAELAEE RVDHRFKGLP PDAYGLTLAE LAGQRRNLFT GGFTTPVLAL        60
     SAERLEHNLK LMETYSARHG LAFAPHGKTS MAPQLFHRQI EHGAWGITLA VPHQVRVARA       120
     FGVQRVFLAN ELVDAAALRW ISAELDADPG FRFVCYADSV RGVELMDAAL TDAGAARPLD       180
     VVVELAAGAG ARTGVRTEAG CAAVADAVAG ARTLRLAGVA GYEGEVPDAD PERVHAWLRR       240
     LVALAVDFDR AGRFDGLEEI VLSAGGSAWF DAVADVFAEV PGLSLPVLKL LRSGAYVSHD       300
     DGHYRELTPF NRVPEEGALE PAFRLWSQVV SRPSPEQAFT NAGKRDAAYD LHLPFAQVVR       360
     PADGGPERPA TGVEVTGLSD QHAWLRTSGE ADLAVGDWVG AGLSHPCTSF DKWQLIPVAQ       420
     ADGTVVDYIR TFF                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page