(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4988

AL939122.SCO4988     Location/Qualifiers
FT   CDS             57114..58169
FT                   /transl_table=11
FT                   /gene="SCO4988"
FT                   /gene_synonym="2SCK36.11"
FT                   /product="putative carbohydrate kinase"
FT                   /note="2SCK36.11, probable carbohydrate kinase, len: 351
FT                   aa; similar to TR:Q9K6K5 (EMBL:AP001519) Bacillus
FT                   halodurans 2-keto-3-deoxygluconate kinase (EC 2.7.1.45)
FT                   KdgK or BH3724, 317 aa; fasta scores: opt: 578 Z-score:
FT                   638.8 bits: 126.5 E(): 5.7e-28; 38.835% identity in 309 aa
FT                   overlap. Contains Pfam match to entry PF00294 pfkB, pfkB
FT                   family carbohydrate kinase"
FT                   /db_xref="GOA:Q93JK6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK6"
FT                   /protein_id="CAC40601.1"
FT                   /translation="MTVDGPRSTAPDVVDVVALGESMVTFLPSRPGRLADVPSFDRAIG
FT                   GAESNVACVLAAAGHSARWAGRVGADGFGDHLVEAIGAYGVDVSAVRRDPARPTGVYFR
FT                   TAGDRATDAHEVAYYRAGSAASAMSVDTMDLDAIRSGRVLHLSGITPALSAGCLGLMRE
FT                   LTARRPGRPLVSFDVNHRPGLWRDARHGHGPEVLLELARGADLVFVGDDEARDAWGLGG
FT                   PEAVRAALPEPELLVVKQGASGATAFHGTDATSVPALHVDVVAAVGAGDAFAAGFLSAT
FT                   LRGKPVRERLRHGHLWAAAALTVPADLAAPPARGHADRLVALDDTAWGRLRLGPGWTHA
FT                   EEGAEEEVRTP"
     MTVDGPRSTA PDVVDVVALG ESMVTFLPSR PGRLADVPSF DRAIGGAESN VACVLAAAGH        60
     SARWAGRVGA DGFGDHLVEA IGAYGVDVSA VRRDPARPTG VYFRTAGDRA TDAHEVAYYR       120
     AGSAASAMSV DTMDLDAIRS GRVLHLSGIT PALSAGCLGL MRELTARRPG RPLVSFDVNH       180
     RPGLWRDARH GHGPEVLLEL ARGADLVFVG DDEARDAWGL GGPEAVRAAL PEPELLVVKQ       240
     GASGATAFHG TDATSVPALH VDVVAAVGAG DAFAAGFLSA TLRGKPVRER LRHGHLWAAA       300
     ALTVPADLAA PPARGHADRL VALDDTAWGR LRLGPGWTHA EEGAEEEVRT P                351
//

If you have problems or comments...

PBIL Back to PBIL home page