(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4989

AL939122.SCO4989     Location/Qualifiers
FT   CDS             58166..58930
FT                   /transl_table=11
FT                   /gene="SCO4989"
FT                   /gene_synonym="2SCK36.12"
FT                   /product="putative IclR-family transcriptional regulatory
FT                   protein"
FT                   /note="2SCK36.12, probable IclR-family transcriptional
FT                   regulatory protein, len: 254 aa; similar to SW:KDGR_ECOLI
FT                   (EMBL:AE000277) Escherichia coli transcriptional regulator
FT                   KdgR, 263 aa; fasta scores: opt: 420 Z-score: 488.7 bits:
FT                   98.0 E(): 1.3e-19; 30.992% identity in 242 aa overlap.
FT                   Contains Pfam match to entry PF01614 IclR, Bacterial
FT                   transcriptional regulator and possible helix-turn-helix
FT                   motif at residues 20..41 (+3.12 SD)"
FT                   /db_xref="GOA:Q93JK5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK5"
FT                   /protein_id="CAC40602.1"
FT                   /translation="MSQTVDRALSILPLLAEGPADLGRVADRLGVHKSTALRLLRTLHD
FT                   HGFVYRQSDQRYRLGARLISLAQEAMENLDVREIAHPHLVRLNEQVGHTVHLAVHEEDE
FT                   VLYIDKVESRYPVRMYSRIGKPVAITVAAVAKLLLADLPEDERRAVAEQLDYPMYTARS
FT                   TPNADGFLKELAKVREQGWATDLGGHEESINCVAAPIRGADGRVVAAMSVSAPNVVVTA
FT                   DELLTLLPLVRRTADAISGEYSGRTPVKEVTA"
     MSQTVDRALS ILPLLAEGPA DLGRVADRLG VHKSTALRLL RTLHDHGFVY RQSDQRYRLG        60
     ARLISLAQEA MENLDVREIA HPHLVRLNEQ VGHTVHLAVH EEDEVLYIDK VESRYPVRMY       120
     SRIGKPVAIT VAAVAKLLLA DLPEDERRAV AEQLDYPMYT ARSTPNADGF LKELAKVREQ       180
     GWATDLGGHE ESINCVAAPI RGADGRVVAA MSVSAPNVVV TADELLTLLP LVRRTADAIS       240
     GEYSGRTPVK EVTA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page