(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4990

AL939122.SCO4990     Location/Qualifiers
FT   CDS             58927..59337
FT                   /transl_table=11
FT                   /gene="SCO4990"
FT                   /gene_synonym="2SCK36.13"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK36.13, conserved hypothetical protein, len: 136
FT                   aa; similar to SW:YABJ_BACSU (EMBL:D26185) Bacillus
FT                   subtilis putative regulator of purine biosynthesis YabJ,
FT                   124 aa; fasta scores: opt: 239 Z-score: 301.4 bits: 61.4
FT                   E(): 3.5e-09; 36.641% identity in 131 aa overlap. Contains
FT                   Pfam match to entry PF01042 UPF0076, YjgF family"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK4"
FT                   /protein_id="CAC40603.1"
FT                   /translation="MTDKIALVPATHTVPPAKFSHGVKKGNILQVAGQVGFLPHEEGKA
FT                   PTPAGPTLREQTLQTLANVKAILEEGGASWDDVMMLRVYLTDVDHFAEMNEIYNAYFAE
FT                   QGLTQPPAARTTVYVGLPAGLLIEIDALAVLG"
     MTDKIALVPA THTVPPAKFS HGVKKGNILQ VAGQVGFLPH EEGKAPTPAG PTLREQTLQT        60
     LANVKAILEE GGASWDDVMM LRVYLTDVDH FAEMNEIYNA YFAEQGLTQP PAARTTVYVG       120
     LPAGLLIEID ALAVLG                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page