(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4992

AL939122.SCO4992     Location/Qualifiers
FT   CDS             61032..61676
FT                   /transl_table=11
FT                   /gene="SCO4992"
FT                   /gene_synonym="2SCK36.15"
FT                   /product="hypothetical protein 2SCK36.15"
FT                   /note="2SCK36.15, unknown, len: 214 aa. High content of
FT                   alanine and glutamic amino acid residues in C-terminal
FT                   region"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK2"
FT                   /protein_id="CAC40605.1"
FT                   /translation="MEQRRGSTSQPLEGAGFDPAFIPGLTAPVSGEPEDVRRAEDEAEK
FT                   DADAETEESSHSPAADEPPAEDAEDAEEPDAEAPVDGPVFEASDRRAKIVADHRGVRLS
FT                   LDDQACEFRWDEVGAVETETGRFGKRFTVTVHTPDRRWYPIEIEAASRSRFAEWESALD
FT                   EVLDAYFEDGEAESETEAEAVEAAETADTADTAEKDAEDAEGAEEAKARAE"
     MEQRRGSTSQ PLEGAGFDPA FIPGLTAPVS GEPEDVRRAE DEAEKDADAE TEESSHSPAA        60
     DEPPAEDAED AEEPDAEAPV DGPVFEASDR RAKIVADHRG VRLSLDDQAC EFRWDEVGAV       120
     ETETGRFGKR FTVTVHTPDR RWYPIEIEAA SRSRFAEWES ALDEVLDAYF EDGEAESETE       180
     AEAVEAAETA DTADTAEKDA EDAEGAEEAK ARAE                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page