(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4994

AL939122.SCO4994     Location/Qualifiers
FT   CDS             63210..64163
FT                   /transl_table=11
FT                   /gene="SCO4994"
FT                   /gene_synonym="2SCK36.17"
FT                   /product="hypothetical protein 2SCK36.17"
FT                   /note="2SCK36.17, unknown, len: 317 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK0"
FT                   /protein_id="CAC40607.1"
FT                   /translation="MRGHDRQSDHELTGRRSAGDRGPVVRTDRAASTAGQAWSAGDLSP
FT                   HAVSDLQNSAGNAAVAASLAGQRQQHGSQPPVQRMFQKMKNAVSGNRSAAQQEVNVRVG
FT                   EDDIPMTRQGAFYVFRTPQGGRAYIHDVAVVNGVLNDDLTPHVMKYRMGGLALYRGIPR
FT                   HHETWHDVNGGGVIPPLGSGELPDYATNNTSFIPFSPSERVARGSAVATRGMAERNRAE
FT                   YVQGYSRSNENFFVGLVATVVAGPNLDVGFFNGGEVQIRGPVHGFETDHIRMGTDVQEA
FT                   LTGTPGDPREPISENRPNTPNEEQKKEFEKEHGMLP"
     MRGHDRQSDH ELTGRRSAGD RGPVVRTDRA ASTAGQAWSA GDLSPHAVSD LQNSAGNAAV        60
     AASLAGQRQQ HGSQPPVQRM FQKMKNAVSG NRSAAQQEVN VRVGEDDIPM TRQGAFYVFR       120
     TPQGGRAYIH DVAVVNGVLN DDLTPHVMKY RMGGLALYRG IPRHHETWHD VNGGGVIPPL       180
     GSGELPDYAT NNTSFIPFSP SERVARGSAV ATRGMAERNR AEYVQGYSRS NENFFVGLVA       240
     TVVAGPNLDV GFFNGGEVQI RGPVHGFETD HIRMGTDVQE ALTGTPGDPR EPISENRPNT       300
     PNEEQKKEFE KEHGMLP                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page