(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4996

AL939122.SCO4996     Location/Qualifiers
FT   CDS             complement(65560..66069)
FT                   /transl_table=11
FT                   /gene="SCO4996"
FT                   /gene_synonym="2SCK36.19c"
FT                   /product="putative RNA polymerase ECF sigma factor"
FT                   /note="2SCK36.19c, probable RNA polymerase ECF sigma
FT                   factor, len: 169 aa; similar to SW:RPOE_STRCO (EMBL:L29636)
FT                   Streptomyces coelicolor RNA polymerase sigma-E factor SigE
FT                   or SCE94.07, 176 aa; fasta scores: opt: 278 Z-score: 347.2
FT                   bits: 70.7 E(): 9.9e-12; 36.527% identity in 167 aa
FT                   overlap. Contains Pfam match to entry PF00776 Sigma70_ECF,
FT                   Sigma-70 factor (ECF subfamily)"
FT                   /db_xref="GOA:Q93JJ8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ8"
FT                   /protein_id="CAC40609.1"
FT                   /translation="MRQGRADEYAEFAVARAGHLYRSACLLTAGDTHLAEDLVQETFGR
FT                   LYVRWGRVSRAENPAAYAQTVLTRAFLAHQRRRSSGERATDVFPDLPGAGDGDASLRLT
FT                   LLDALARLPAKDRAVVVLRYWDDRSVEQTADVLGVSSAAVRTRCSRALGRLRELLGEDL
FT                   SEYARP"
     MRQGRADEYA EFAVARAGHL YRSACLLTAG DTHLAEDLVQ ETFGRLYVRW GRVSRAENPA        60
     AYAQTVLTRA FLAHQRRRSS GERATDVFPD LPGAGDGDAS LRLTLLDALA RLPAKDRAVV       120
     VLRYWDDRSV EQTADVLGVS SAAVRTRCSR ALGRLRELLG EDLSEYARP                   169
//

If you have problems or comments...

PBIL Back to PBIL home page