(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4998

AL939122.SCO4998     Location/Qualifiers
FT   CDS             complement(66371..67222)
FT                   /transl_table=11
FT                   /gene="SCO4998"
FT                   /gene_synonym="2SCK36.21c"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK36.21c, hypothetical protein, len: 283 aa;
FT                   similar to TR:Q9XD96 (EMBL:AF106004) Streptomyces
FT                   coelicolor hypothetical 31.8 kDa protein ORF3, 283 aa;
FT                   fasta scores: opt: 815 Z-score: 959.3 bits: 185.4 E():
FT                   8e-46; 45.230% identity in 283 aa overlap. Contains Pfam
FT                   match to entry PF01381 HTH_3, Helix-turn-helix"
FT                   /db_xref="GOA:Q93JJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ6"
FT                   /protein_id="CAC40611.1"
FT                   /translation="MPPRTTPTERQRRLGAELRKMRTAAGITADQAAGLLGLDRAKVSN
FT                   IETGIRTISPERLRTLACNCDCSDEAYVEALVRMARPGARGWWERYRGSLSAGLLDIAE
FT                   FEAQATRMRTIHIAHIPGLLQTSDHALELFRAVLPLLPEHEVALRLAYRVERQRVLEGD
FT                   DPPEYVAVVHEAAVRMQFGGPTVARAQLEHLVAVSERPTVRLLVVPFTAGAFPGSGQIF
FT                   NYLEGPVPQLDTVQIDSTHGPEFLSGEAQLAKYRTHLDRMERIALSPQASRDFIRDVAN
FT                   GL"
     MPPRTTPTER QRRLGAELRK MRTAAGITAD QAAGLLGLDR AKVSNIETGI RTISPERLRT        60
     LACNCDCSDE AYVEALVRMA RPGARGWWER YRGSLSAGLL DIAEFEAQAT RMRTIHIAHI       120
     PGLLQTSDHA LELFRAVLPL LPEHEVALRL AYRVERQRVL EGDDPPEYVA VVHEAAVRMQ       180
     FGGPTVARAQ LEHLVAVSER PTVRLLVVPF TAGAFPGSGQ IFNYLEGPVP QLDTVQIDST       240
     HGPEFLSGEA QLAKYRTHLD RMERIALSPQ ASRDFIRDVA NGL                         283
//

If you have problems or comments...

PBIL Back to PBIL home page