(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5001

AL939122.SCO5001     Location/Qualifiers
FT   CDS             68611..69252
FT                   /transl_table=11
FT                   /gene="SCO5001"
FT                   /gene_synonym="SCK15.03"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.03, possible integral membrane protein, len:
FT                   213 aa; similar to TR:CAB77310 (EMBL:AL160312) Streptomyces
FT                   coelicolor putative integral membrane protein SCD35.26, 198
FT                   aa; fasta scores: opt: 349 z-score: 424.5 E(): 3.6e-16;
FT                   37.4% identity in 182 aa overlap. Contains possible
FT                   hydrophobic membrane spanning regions at C-terminal domain"
FT                   /db_xref="GOA:Q9KYA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KYA1"
FT                   /protein_id="CAB92594.1"
FT                   /translation="MSLRRHLGKLLRATGEDGRPSGSAHAPGSSGETVASFTTEVPWPS
FT                   LRKFAQFAYIAEQYGYRYSGLDPDLRDSGTPFFVFRRLPDAGERAARTRGSFPGAPENG
FT                   RLPGMRAWPLPVLTLPAARSEVKLLLARIVVDYYGALGRQRMRPWLIGIPVVFLLFLLV
FT                   NGELHATGLRVAAGMAVALIVVLTASRVFMRRRRATYRRLLERSGLGPPP"
     MSLRRHLGKL LRATGEDGRP SGSAHAPGSS GETVASFTTE VPWPSLRKFA QFAYIAEQYG        60
     YRYSGLDPDL RDSGTPFFVF RRLPDAGERA ARTRGSFPGA PENGRLPGMR AWPLPVLTLP       120
     AARSEVKLLL ARIVVDYYGA LGRQRMRPWL IGIPVVFLLF LLVNGELHAT GLRVAAGMAV       180
     ALIVVLTASR VFMRRRRATY RRLLERSGLG PPP                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page