(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5002

AL939122.SCO5002     Location/Qualifiers
FT   CDS             complement(69185..69835)
FT                   /transl_table=11
FT                   /gene="SCO5002"
FT                   /gene_synonym="SCK15.04c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK15.04c, conserved hypothetical protein, len: 216
FT                   aa; similar to TR:CAB77308 (EMBL:AL160312) Streptomyces
FT                   coelicolor hypothetical 26.0 kD protein SCD35.24c, 241 aa;
FT                   fasta scores: opt: 613 z-score: 732.4 E(): 0; 52.8%
FT                   identity in 197 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KYA0"
FT                   /protein_id="CAB92595.1"
FT                   /translation="MPGADALERVQSAERMRHSLPMFLDRDDTLVDIAMCLGAERVRDE
FT                   DKLSYGLLVVSVRPSGHDDRLLAAEGIYRAKERLFFTREAEVEELDFALGKGGRGQQDM
FT                   LLAAKLPGGPGVMSASLRTVELRTAGQAASGGEDAAAQKIPMAVLQLICPAPRDYCTYI
FT                   TIATPSVYLLDSYTERLAHIGRTFVFEAPTPLTEAGRAPTAQAAAGTSHGDGA"
     MPGADALERV QSAERMRHSL PMFLDRDDTL VDIAMCLGAE RVRDEDKLSY GLLVVSVRPS        60
     GHDDRLLAAE GIYRAKERLF FTREAEVEEL DFALGKGGRG QQDMLLAAKL PGGPGVMSAS       120
     LRTVELRTAG QAASGGEDAA AQKIPMAVLQ LICPAPRDYC TYITIATPSV YLLDSYTERL       180
     AHIGRTFVFE APTPLTEAGR APTAQAAAGT SHGDGA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page