(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5003

AL939122.SCO5003     Location/Qualifiers
FT   CDS             complement(69963..71678)
FT                   /transl_table=11
FT                   /gene="SCO5003"
FT                   /gene_synonym="chiA"
FT                   /gene_synonym="SCK15.05c"
FT                   /product="chinitase A precursor"
FT                   /note="SCK15.05c, chiA, chinitase A precursor, len: 571 aa;
FT                   identical to previously sequenced TR:Q9Z9M9 (EMBL:AB017008)
FT                   Streptomyces coelicolor chinitase A precursor ChiA, 571 aa
FT                   and to TR:Q59924 (EMBL:D13775) Streptomyces lividans
FT                   chitinase A precursor (EC 3.2.1.14) ChiA, 571 aa. Contains
FT                   Pfam match to entry PF02018 CBD_6, Cellulose binding
FT                   domain, PF00041 fn3, Fibronectin type III domain, PF00704
FT                   Glyco_hydro_18, Glycosyl hydrolases family 18 and matches
FT                   to Prosite entries PS00678 Trp-Asp (WD) repeats signature
FT                   and PS01095 Chitinases family 18 active site. Contains also
FT                   possible N-terminal region signal peptide sequence"
FT                   /db_xref="GOA:Q9KY99"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY99"
FT                   /protein_id="CAB92596.1"
FT                   /translation="MDPVRRRSRGRRLGSLTGAVTAALALAFTAVGPASAADVNNAKNA
FT                   GFESGLSNWACSANSGTTVASPAHAGSAALKATPAGQDNARCSQSVAVKPNSTYTLSAW
FT                   VQGGYSYLGVTGTGTTDVSTWTPDSTAWKQLKTTFSTGSSTTSVSVYTHGWYGQAAYYV
FT                   DDLSVFGPDGGGGDGGNPDPTVPSAPAGLSVSGTTPNSASLSWNTVSGATGYNVYRDGT
FT                   KVTAVTGTSATVTGLAASTSYSFQVTATNAAGESVKSAAVTARTTAPDDGGNGGDLPKH
FT                   AVTGYWQNFNNGATVQKISDVPSAYDIIAVAFADATTTPGAVTFNLDSAGLGGYTVDQF
FT                   KADVRAKQAAGKKVIISVGGEKGTVSVNSSASATNFANSVYSVMREYGFDGVDIDLENG
FT                   LNPTYMTQALRALSAKAGPDMILTMAPQTIDMQSTQGGYFQTALNVKDILTVVNMQYYN
FT                   SGTMLGCDGKVYAQGTVDFLTALACIQLEGGLAPSQVGLGLPASTRAAGGGYVSPSVVN
FT                   AALDCLTKATNCGSFKPSKTYPDLRGAMTWSTNWDATAGNAWSNSVGAHVHALP"
     MDPVRRRSRG RRLGSLTGAV TAALALAFTA VGPASAADVN NAKNAGFESG LSNWACSANS        60
     GTTVASPAHA GSAALKATPA GQDNARCSQS VAVKPNSTYT LSAWVQGGYS YLGVTGTGTT       120
     DVSTWTPDST AWKQLKTTFS TGSSTTSVSV YTHGWYGQAA YYVDDLSVFG PDGGGGDGGN       180
     PDPTVPSAPA GLSVSGTTPN SASLSWNTVS GATGYNVYRD GTKVTAVTGT SATVTGLAAS       240
     TSYSFQVTAT NAAGESVKSA AVTARTTAPD DGGNGGDLPK HAVTGYWQNF NNGATVQKIS       300
     DVPSAYDIIA VAFADATTTP GAVTFNLDSA GLGGYTVDQF KADVRAKQAA GKKVIISVGG       360
     EKGTVSVNSS ASATNFANSV YSVMREYGFD GVDIDLENGL NPTYMTQALR ALSAKAGPDM       420
     ILTMAPQTID MQSTQGGYFQ TALNVKDILT VVNMQYYNSG TMLGCDGKVY AQGTVDFLTA       480
     LACIQLEGGL APSQVGLGLP ASTRAAGGGY VSPSVVNAAL DCLTKATNCG SFKPSKTYPD       540
     LRGAMTWSTN WDATAGNAWS NSVGAHVHAL P                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page