(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5004

AL939122.SCO5004     Location/Qualifiers
FT   CDS             71997..72938
FT                   /transl_table=11
FT                   /gene="SCO5004"
FT                   /gene_synonym="SCK15.06"
FT                   /product="hypothetical protein SCK15.06"
FT                   /note="SCK15.06, unknown, len: 313 aa. Contains hydrohilic
FT                   C-terminall region"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY98"
FT                   /protein_id="CAB92597.1"
FT                   /translation="MGDGEPRVPTAIAVTSADLALPPQDERTLPAAVLQDVDRRPLESV
FT                   LAELQTLVDQCGHVIVVCSQAVPASVERRLHTVRALLETDRIALFRPPLPPLGIAVLAR
FT                   QLRQLASCDLSPGVLASAGRLLTHYIHAGALLGSVARLDHVPVGLKAHARSWVPGSQFG
FT                   VVAHPVPQLVRIGPEAALAGPEFGTWLLVAKGQHPTDWVTGSLAPSWHVQGLRETALPA
FT                   ESATWWGTGRLTEFCAYLPDLSVLYQLVTSVRRGTCHWCGIDVIGDRCVFCSATPPVYD
FT                   DGGAGGGGRDRALAPRRDPALGRRRERRALTG"
     MGDGEPRVPT AIAVTSADLA LPPQDERTLP AAVLQDVDRR PLESVLAELQ TLVDQCGHVI        60
     VVCSQAVPAS VERRLHTVRA LLETDRIALF RPPLPPLGIA VLARQLRQLA SCDLSPGVLA       120
     SAGRLLTHYI HAGALLGSVA RLDHVPVGLK AHARSWVPGS QFGVVAHPVP QLVRIGPEAA       180
     LAGPEFGTWL LVAKGQHPTD WVTGSLAPSW HVQGLRETAL PAESATWWGT GRLTEFCAYL       240
     PDLSVLYQLV TSVRRGTCHW CGIDVIGDRC VFCSATPPVY DDGGAGGGGR DRALAPRRDP       300
     ALGRRRERRA LTG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page