(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5006

AL939122.SCO5006     Location/Qualifiers
FT   CDS             73832..75088
FT                   /transl_table=11
FT                   /gene="SCO5006"
FT                   /gene_synonym="minD1"
FT                   /gene_synonym="SCK15.08"
FT                   /product="putative septum site-determining protein"
FT                   /note="SCK15.08, minD1, possible septum site-determining
FT                   protein, len: 418 aa; N-terminal domain similar to
FT                   TR:Q9RZD9 (EMBL:AE001862) Deinococcus radiodurans
FT                   DNA-binding response regulator DRA0010, 211 aa; blastp
FT                   scores: Score = 103 (36.3 bits), Expect = 0.0045,
FT                   Identities = 50/194 (25%), Positives = 85/194 (43%) and
FT                   C-terminal domain highly similar to TR:Q9ZF15
FT                   (EMBL:AJ005576) Streptomyces griseus septum
FT                   site-determining protein MinD protein, 396 aa; fasta
FT                   scores: opt: 1230 z-score: 1302.8 E(): 0; 70.5% identity in
FT                   281 aa overlap. Contains Pfam matches to entries PF00072
FT                   response_reg, Response regulator receiver domain and
FT                   PF00991 ParA, ParA family ATPase"
FT                   /db_xref="GOA:Q9KY96"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY96"
FT                   /protein_id="CAB92599.1"
FT                   /translation="MATRILPAVGDPDAVRSLTTLLSQLPEAEPVAPVTDSTQLVDTLA
FT                   RLAAESVDELPEVVIVHERIGPVPALELIREVALRFPAVGVILVTSDPGPGLFQAAMDH
FT                   GARGLVALPLGYEELASRVQAVAQWSAGVRRHLGGAVDVFTGTGGTVVTVSGAKGGVGA
FT                   TLTAVQLALAAQASGRSTALLDMDLQTGDVASYLDVQFRRSVADLAAITDLSPRVLADA
FT                   VFRHDSGLALLLAPGEGERGEEITDRAARQIVGALRSRYEVVVVDCGAQLGGAGAAAVE
FT                   SADTALLVTTPDVVAVRGAKRAVRMWERLQIRKAAETTVVVNRHTRGTEIQPPLIQKIT
FT                   GTAIAATTVPANFKELQGAVDAGRVHELDGRSTVKQALWALAGELGLAGVPDAGRKGHG
FT                   RLKGDRGASGFRRRKDGAG"
     MATRILPAVG DPDAVRSLTT LLSQLPEAEP VAPVTDSTQL VDTLARLAAE SVDELPEVVI        60
     VHERIGPVPA LELIREVALR FPAVGVILVT SDPGPGLFQA AMDHGARGLV ALPLGYEELA       120
     SRVQAVAQWS AGVRRHLGGA VDVFTGTGGT VVTVSGAKGG VGATLTAVQL ALAAQASGRS       180
     TALLDMDLQT GDVASYLDVQ FRRSVADLAA ITDLSPRVLA DAVFRHDSGL ALLLAPGEGE       240
     RGEEITDRAA RQIVGALRSR YEVVVVDCGA QLGGAGAAAV ESADTALLVT TPDVVAVRGA       300
     KRAVRMWERL QIRKAAETTV VVNRHTRGTE IQPPLIQKIT GTAIAATTVP ANFKELQGAV       360
     DAGRVHELDG RSTVKQALWA LAGELGLAGV PDAGRKGHGR LKGDRGASGF RRRKDGAG         418
//

If you have problems or comments...

PBIL Back to PBIL home page