(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5010

AL939122.SCO5010     Location/Qualifiers
FT   CDS             77243..78193
FT                   /transl_table=11
FT                   /gene="SCO5010"
FT                   /gene_synonym="SCK15.12"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.12, possible integral membrane protein, len:
FT                   316 aa; similar to TR:AAF40196 (EMBL:AF229646) Caulobacter
FT                   crescentus hypothetical 34.6 kD protein, 325 aa; fasta
FT                   scores: opt: 287 z-score: 328.2 E(): 8.2e-11; 21.9%
FT                   identity in 315 aa overlap. Contains possible N-terminal
FT                   region signal peptide sequence and possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9KY92"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY92"
FT                   /protein_id="CAB92603.1"
FT                   /translation="MEPELDTLVTLTTGVTLLTCVLAIVGLHSYAAGKAQRAALVDRLT
FT                   ATGQAPSAGRRRRFPTLDRRLRRTGLGRNLERRLSATGLDVTPGEFFAYMLATVAGLWL
FT                   IGQAALAPFFGPLAGLLGIGVAIQFLNWQRQKRIEKFINQLPELARILANATQAGLALR
FT                   TAIGMAAEELEAPAGEELGKVADQLAIGASMDDALGELAGRLPSRELVVLVTTLVLSNR
FT                   AGGQVVGALRNLTETLEERKETRREVRTQLSQVTMTSYAVPVLGIGSLLLMNGVKDGAL
FT                   ERMTGSPAGQAAVITAFALYAVGFVLIRRLSRIDV"
     MEPELDTLVT LTTGVTLLTC VLAIVGLHSY AAGKAQRAAL VDRLTATGQA PSAGRRRRFP        60
     TLDRRLRRTG LGRNLERRLS ATGLDVTPGE FFAYMLATVA GLWLIGQAAL APFFGPLAGL       120
     LGIGVAIQFL NWQRQKRIEK FINQLPELAR ILANATQAGL ALRTAIGMAA EELEAPAGEE       180
     LGKVADQLAI GASMDDALGE LAGRLPSREL VVLVTTLVLS NRAGGQVVGA LRNLTETLEE       240
     RKETRREVRT QLSQVTMTSY AVPVLGIGSL LLMNGVKDGA LERMTGSPAG QAAVITAFAL       300
     YAVGFVLIRR LSRIDV                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page