(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5014

AL939122.SCO5014     Location/Qualifiers
FT   CDS             80207..80785
FT                   /transl_table=11
FT                   /gene="SCO5014"
FT                   /gene_synonym="SCK15.16"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.16, possible secreted protein, len: 192 aa.
FT                   Contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY88"
FT                   /protein_id="CAB92607.1"
FT                   /translation="MGIRFAVKVRNGATGLTVAVGLALCVVGCSSGGGDDNKAEASASA
FT                   TAGEQSDPTAQEGTDSPLAELKGEDGLLLTIDSAERDAGGFVTVSGEIKNDGAEAARVP
FT                   IQTRGDETEIMRHGGSLGGATLVDPAKKKRYYVLRDTDGRPLTTTDMPRIKPGASIPVF
FT                   MQFPAPPTDTGKVTFQLPTFASAPIEISG"
     MGIRFAVKVR NGATGLTVAV GLALCVVGCS SGGGDDNKAE ASASATAGEQ SDPTAQEGTD        60
     SPLAELKGED GLLLTIDSAE RDAGGFVTVS GEIKNDGAEA ARVPIQTRGD ETEIMRHGGS       120
     LGGATLVDPA KKKRYYVLRD TDGRPLTTTD MPRIKPGASI PVFMQFPAPP TDTGKVTFQL       180
     PTFASAPIEI SG                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page