(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5015

AL939122.SCO5015     Location/Qualifiers
FT   CDS             80794..81405
FT                   /transl_table=11
FT                   /gene="SCO5015"
FT                   /gene_synonym="SCK15.17"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.17, possible secreted protein, len: 203 aa;
FT                   similar to many other membrane proteins, e.g. TR:Q9S6B8
FT                   (EMBL:AF115336) Pseudomonas fluorescens major outer
FT                   membrane protein OprF, 343 aa; fasta scores: opt: 247
FT                   z-score: 285.4 E(): 2e-08; 34.3% identity in 181 aa
FT                   overlap. Contains Pfam match to entry PF00691 OmpA, OmpA
FT                   family and possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="GOA:Q9KY87"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY87"
FT                   /protein_id="CAB92608.1"
FT                   /translation="MHNSRVAVLLTTSVLTAASVGVSQSYAADDPPGTEPSASAPVEVD
FT                   PNDPDLKLPDGATLAQAKVLDIKSVVEEQSGDERREDTNTSVTLALQAEVLFGKDSSKL
FT                   GAEAKSRIRGIADEIRTQNATRVRVFGFTDDLGSSAHGDVLSKRRANAVHDVLSQSLND
FT                   AGITYEVRGYGEQYPIADNSTEAGRKKNRRVEVSFPRTEP"
     MHNSRVAVLL TTSVLTAASV GVSQSYAADD PPGTEPSASA PVEVDPNDPD LKLPDGATLA        60
     QAKVLDIKSV VEEQSGDERR EDTNTSVTLA LQAEVLFGKD SSKLGAEAKS RIRGIADEIR       120
     TQNATRVRVF GFTDDLGSSA HGDVLSKRRA NAVHDVLSQS LNDAGITYEV RGYGEQYPIA       180
     DNSTEAGRKK NRRVEVSFPR TEP                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page