(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5017

AL939122.SCO5017     Location/Qualifiers
FT   CDS             82526..83623
FT                   /transl_table=11
FT                   /gene="SCO5017"
FT                   /gene_synonym="SCK15.19"
FT                   /product="putative araC family regulatory protein"
FT                   /note="SCK15.19, possible araC family regulatory protein,
FT                   len: 365 aa; similar to TR:Q54308 (EMBL:X86780)
FT                   Streptomyces hygroscopicus helix-turn-helix DNA-binding
FT                   protein, 330 aa; fasta scores: opt: 247 z-score: 294.6 E():
FT                   6.1e-09; 28.6% identity in 346 aa overlap. Contains fam
FT                   match to entry PF00165 HTH_AraC, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family and match to Prosite
FT                   entry PS00041 Bacterial regulatory proteins, araC family
FT                   signature. Contains also a TTA leucine codon, possible
FT                   target for bldA regulation"
FT                   /db_xref="GOA:Q9KY85"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY85"
FT                   /protein_id="CAB92610.1"
FT                   /translation="MPGDEQPRRGRRHTERGTAVEQTGTWDASVFLSTDSVSGPEGFGW
FT                   WGDMVSRAVMPVSIASEHAGHFKGEVTTLELVDTDFSAFSFSPMSARRTPDHIRASDPE
FT                   NYYLFLVHGSPIGLEQRRNNALLRAGDVALFDTSQPLACEFQDQGRPSRVSVLRLPRTA
FT                   LPLPGDRTDRLVATPLPARTGSGALLTSYLAGLRENAAHCGPTELRRLGTMALELAVTF
FT                   LAARLDSPPALPAESRRRVLLARINAYIDHNLHDPDLGPATIAAHHHISIRLLHALFEE
FT                   EPETVGATIRRRRLERSRTDLGDPRLRHRTIGEIAARWGFRHPAAFSRTFREAYGISPT
FT                   EARTALHDKQPCTPRRGPGHRTLAP"
     MPGDEQPRRG RRHTERGTAV EQTGTWDASV FLSTDSVSGP EGFGWWGDMV SRAVMPVSIA        60
     SEHAGHFKGE VTTLELVDTD FSAFSFSPMS ARRTPDHIRA SDPENYYLFL VHGSPIGLEQ       120
     RRNNALLRAG DVALFDTSQP LACEFQDQGR PSRVSVLRLP RTALPLPGDR TDRLVATPLP       180
     ARTGSGALLT SYLAGLRENA AHCGPTELRR LGTMALELAV TFLAARLDSP PALPAESRRR       240
     VLLARINAYI DHNLHDPDLG PATIAAHHHI SIRLLHALFE EEPETVGATI RRRRLERSRT       300
     DLGDPRLRHR TIGEIAARWG FRHPAAFSRT FREAYGISPT EARTALHDKQ PCTPRRGPGH       360
     RTLAP                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page