(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5018

AL939122.SCO5018     Location/Qualifiers
FT   CDS             83774..83983
FT                   /transl_table=11
FT                   /gene="SCO5018"
FT                   /gene_synonym="SCK15.20"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.20, possible integral membrane protein, len:
FT                   69 aa. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9KY84"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY84"
FT                   /protein_id="CAB92611.1"
FT                   /translation="MHGDSSWHTTRSVPSIVVVVLIVIWTVFAVQWKEKDCALVPTSYL
FT                   LVITHGTPSVFEGCGDHAIDVTDD"
     MHGDSSWHTT RSVPSIVVVV LIVIWTVFAV QWKEKDCALV PTSYLLVITH GTPSVFEGCG        60
     DHAIDVTDD                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page