(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5019

AL939122.SCO5019     Location/Qualifiers
FT   CDS             complement(83993..84598)
FT                   /transl_table=11
FT                   /gene="SCO5019"
FT                   /gene_synonym="SCK15.21c"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.21c, possible secreted protein, len: 201 aa;
FT                   similar to TR:Q9UZM5 (EMBL:AJ248286;) Pyrococcus abyssi
FT                   hypothetical 13.4 kD protein, 117 aa; fasta scores: opt:
FT                   167 z-score: 206.8 E(): 0.00048; 31.0% identity in 100 aa
FT                   overlap. Contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY83"
FT                   /protein_id="CAB92612.1"
FT                   /translation="MPISASATASFPLPGLSSLPHADSVKAAVAVSVSAVKRAGQRALT
FT                   IGSWVGRGFSSAKQFCTEGIGMGRQRWRDGAGALVVVGQSGEGACVPLEIAGSYRARTK
FT                   GLLGRGSVDGAMLLTPANSVHTFRMRMAIDVAYLDRRLNVIAVRTMRPGRLGLPRLRAR
FT                   HVLEAEAGAMDEWGVRVGARVEVVEGSAESADGAGRLG"
     MPISASATAS FPLPGLSSLP HADSVKAAVA VSVSAVKRAG QRALTIGSWV GRGFSSAKQF        60
     CTEGIGMGRQ RWRDGAGALV VVGQSGEGAC VPLEIAGSYR ARTKGLLGRG SVDGAMLLTP       120
     ANSVHTFRMR MAIDVAYLDR RLNVIAVRTM RPGRLGLPRL RARHVLEAEA GAMDEWGVRV       180
     GARVEVVEGS AESADGAGRL G                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page