(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5020

AL939122.SCO5020     Location/Qualifiers
FT   CDS             84591..85127
FT                   /transl_table=11
FT                   /gene="SCO5020"
FT                   /gene_synonym="SCK15.22"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK15.22, hypothetical protein, len: 178 aa; similar
FT                   to C-terminal region of TR:Q9KY81 (EMBL:AL356813)
FT                   Streptomyces coelicolor putative lipoprotein SCK15.23, 221
FT                   aa; fasta scores: opt: 444 Z-score: 519.8 E(): 2.5e-21;
FT                   39.080% identity in 174 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY82"
FT                   /protein_id="CAB92613.1"
FT                   /translation="MGTTSPSASPTESESSKAGRPKIELPADLSYSFEWPKSGDQVKDA
FT                   ILADAEQSIKAVDLAIVNQDALDKAYLYYYEGEAAAGTQKFIQNYVDQKAGITGRYRFY
FT                   APEVAVDEDGTASFTYCEDQGRAYVKYLETNKVRRTEVSAQSYVIYHTSLKKNGEGVWE
FT                   IQKIDSQSGSAKCRP"
     MGTTSPSASP TESESSKAGR PKIELPADLS YSFEWPKSGD QVKDAILADA EQSIKAVDLA        60
     IVNQDALDKA YLYYYEGEAA AGTQKFIQNY VDQKAGITGR YRFYAPEVAV DEDGTASFTY       120
     CEDQGRAYVK YLETNKVRRT EVSAQSYVIY HTSLKKNGEG VWEIQKIDSQ SGSAKCRP         178
//

If you have problems or comments...

PBIL Back to PBIL home page