(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5022

AL939122.SCO5022     Location/Qualifiers
FT   CDS             86221..86883
FT                   /transl_table=11
FT                   /gene="SCO5022"
FT                   /gene_synonym="SCK15.24"
FT                   /product="putative lipoprotein"
FT                   /note="SCK15.24, possible lipoprotein, len: 220 aa; similar
FT                   to Streptomyces coelicolor SCK15.23, 221 aa; fasta scores:
FT                   opt: 736 z-score: 703.5 E(): 1.3e-33; 54.3% identity in 221
FT                   aa overlap. Contains correctly situated match to Prosite
FT                   entry PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site and possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY80"
FT                   /protein_id="CAB92615.1"
FT                   /translation="MNRRRPTLLAALTLTAAAALTLSACGSDDDGAAKDSDKIAGADTG
FT                   SETSAAPSPSETDTAGRPKITFPSDAKNVFEYEKTGNATKDAALADSTLSVNSVDEAIF
FT                   EGSTDTKALGFYNAESALSDSITYVLGYINKNHTWVGETRYFDYKVSLSGELEAYVTYC
FT                   SDESKSFIKDKKTGKVKDTPTTADSYVLYHAKLAKNAQGVWQTTDIASTRGSKECQP"
     MNRRRPTLLA ALTLTAAAAL TLSACGSDDD GAAKDSDKIA GADTGSETSA APSPSETDTA        60
     GRPKITFPSD AKNVFEYEKT GNATKDAALA DSTLSVNSVD EAIFEGSTDT KALGFYNAES       120
     ALSDSITYVL GYINKNHTWV GETRYFDYKV SLSGELEAYV TYCSDESKSF IKDKKTGKVK       180
     DTPTTADSYV LYHAKLAKNA QGVWQTTDIA STRGSKECQP                             220
//

If you have problems or comments...

PBIL Back to PBIL home page