(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5023

AL939122.SCO5023     Location/Qualifiers
FT   CDS             86892..87902
FT                   /transl_table=11
FT                   /gene="SCO5023"
FT                   /gene_synonym="SCK15.25"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.25, possible secreted protein, len: 336 aa;
FT                   similar to TR:CAB77312 (EMBL:AL160312) Streptomyces
FT                   coelicolor putative secreted protein SCD35.28c, 361 aa;
FT                   fasta scores: opt: 890 z-score: 972.2 E(): 0; 47.3%
FT                   identity in 357 aa overlap. Contains possible N-terminal
FT                   region signal peptide sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY79"
FT                   /protein_id="CAB92616.1"
FT                   /translation="MRCATVAAIVLVSVISAPMAFAGGRGEGGSRGSTDQQANADGNGT
FT                   VSVTVGGVVFDRSKNGSGDSVGAVTSSTSWSPPACWYAPKYTPEELQDYLEPIWEAEST
FT                   GYEWDAKQREKYNAKDEKKGFNKDKTGKGFWWGSYVNESFPPGWDKCDTDYFWVDTGDP
FT                   PPADKENAVTPEVLAELAYAEIRVPGTEVTLAPAEATKVNLPTWAWLDGAEFKPVSVTA
FT                   SVKEIGIEATATAEPVSLQIKPGTPDAETYPASGVCEIKNGRIGAPYEKGRADDAPPCG
FT                   VKYLRSSGDGTFPLQATVTWEIHWTGTGGAGGDLPDGTFGATQDVVVQEIQAVNR"
     MRCATVAAIV LVSVISAPMA FAGGRGEGGS RGSTDQQANA DGNGTVSVTV GGVVFDRSKN        60
     GSGDSVGAVT SSTSWSPPAC WYAPKYTPEE LQDYLEPIWE AESTGYEWDA KQREKYNAKD       120
     EKKGFNKDKT GKGFWWGSYV NESFPPGWDK CDTDYFWVDT GDPPPADKEN AVTPEVLAEL       180
     AYAEIRVPGT EVTLAPAEAT KVNLPTWAWL DGAEFKPVSV TASVKEIGIE ATATAEPVSL       240
     QIKPGTPDAE TYPASGVCEI KNGRIGAPYE KGRADDAPPC GVKYLRSSGD GTFPLQATVT       300
     WEIHWTGTGG AGGDLPDGTF GATQDVVVQE IQAVNR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page