(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5024

AL939122.SCO5024     Location/Qualifiers
FT   CDS             88019..88891
FT                   /transl_table=11
FT                   /gene="SCO5024"
FT                   /gene_synonym="SCK15.26"
FT                   /product="putative oxidoreductase"
FT                   /note="SCK15.26, possible oxidoreductase, len: 290 aa;
FT                   similar to TR:Q9UXP0 (EMBL:AJ011519) Methanolobus tindarius
FT                   F420-dependent N5,N10-methylene-tetrahydromethanopterin
FT                   reductase, putative FfdA, 326 aa; fasta scores: opt: 323
FT                   z-score: 369.8 E(): 4e-13; 28.3% identity in 240 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9KY78"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY78"
FT                   /protein_id="CAB92617.1"
FT                   /translation="MTGLGAVFRPQLAPERLRAVARVADEVGLEELWLWEDCFREGGIS
FT                   TAAAALAWTERVRVGVGLLPVPLRNVAVTAMEAATLHRMFPGRPVLGVGHGVQDWMGQV
FT                   GARAESPLTLLREHLVALRELLRGGRVTSTGRYVRLDDVALDWPPEQPVEVLAGATGPR
FT                   SLRLAGEAADGTVLTANTPPDGVRRARRLIDEGRAASGRTEAHRVVVYLLAATGSGAAE
FT                   RLRNELVAEGVGAVPDLGVAGDAQAVADAVRRLAEAGADTVILQPTGDEPDPEGFVRFA
FT                   AERVRPLVA"
     MTGLGAVFRP QLAPERLRAV ARVADEVGLE ELWLWEDCFR EGGISTAAAA LAWTERVRVG        60
     VGLLPVPLRN VAVTAMEAAT LHRMFPGRPV LGVGHGVQDW MGQVGARAES PLTLLREHLV       120
     ALRELLRGGR VTSTGRYVRL DDVALDWPPE QPVEVLAGAT GPRSLRLAGE AADGTVLTAN       180
     TPPDGVRRAR RLIDEGRAAS GRTEAHRVVV YLLAATGSGA AERLRNELVA EGVGAVPDLG       240
     VAGDAQAVAD AVRRLAEAGA DTVILQPTGD EPDPEGFVRF AAERVRPLVA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page